DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and AT1G26690

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_564256.1 Gene:AT1G26690 / 839210 AraportID:AT1G26690 Length:214 Species:Arabidopsis thaliana


Alignment Length:207 Identity:57/207 - (27%)
Similarity:110/207 - (53%) Gaps:11/207 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVCLLMACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDVPGQI--------IDYIARD 63
            |:..|...:..|.::.|:|.....||:.|||::|.:.:|::.|.: |.:.        |......
plant    11 ILLFLAISSQVSQSLHFELQSGRTKCISEDIKSNSMTVGKYTVVN-PNEAHPSPQSHKISIRVTS 74

  Fly    64 TKGHILSQKEHITKGKFSFMSEVYDTYEICFISKVPAHQRGVIQEVSLLTKKGVETKSYEGIGEA 128
            :.|:.....|.:..|:|:|.:.....|..|:.:  ..|:..|...:....:.||::||:..:.:.
plant    75 SYGNTYHHAEDVESGQFAFTAVESGDYMACYTA--VDHKPEVTLSIDFDWRTGVQSKSWSSVAKK 137

  Fly   129 SKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCLLGLATWQVL 193
            |:::.:|.|:|||.:..:||..:...:|:|||||::.|..|||::.:.|..|:...||:|..|.:
plant   138 SQVEVMEFDVKRLIETVNSIHEEMFYLREREEEMQNLNRATNSKMAWLSFLSLFVCLGVAGMQFV 202

  Fly   194 YLRRYFKAKKLI 205
            :|:.:|:.||:|
plant   203 HLKTFFEKKKVI 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 50/187 (27%)
AT1G26690NP_564256.1 EMP24_GP25L 24..209 CDD:279450 50/187 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 100 1.000 Domainoid score I2346
eggNOG 1 0.900 - - E1_KOG1691
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2089
OMA 1 1.010 - - QHG53581
OrthoDB 1 1.010 - - D1370889at2759
OrthoFinder 1 1.000 - - FOG0001316
OrthoInspector 1 1.000 - - otm2831
orthoMCL 1 0.900 - - OOG6_101611
Panther 1 1.100 - - LDO PTHR22811
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.