DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and AT1G09580

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_172429.1 Gene:AT1G09580 / 837485 AraportID:AT1G09580 Length:217 Species:Arabidopsis thaliana


Alignment Length:189 Identity:56/189 - (29%)
Similarity:111/189 - (58%) Gaps:4/189 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDVPGQIIDYIA---RDTKGHILSQKEHITKGKFS 81
            ||...:.|...||:.|:||:|.:|:.::.:.....:::..|:   ....|:.|...|::|.|:|:
plant    30 AVWLDVPPTGTKCVSEEIQSNVVVLADYLIISEDHEVMPTISVKVTSPYGNNLHNMENVTHGQFA 94

  Fly    82 FMSEVYDTYEICFISKVPAHQRGVIQEVSLLTKKGVETKSYEGIGEASKLKPLEVDLKRLEDLSD 146
            |.::....|..||.:...:|....: .:::..:.|:..|.:..|.:..|::.:|:::::||...:
plant    95 FTTQESGNYLACFWADEKSHGNKNV-SINIDWRTGIAAKDWASIAKKEKIEGVELEIRKLEGAVE 158

  Fly   147 SIVRDFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCLLGLATWQVLYLRRYFKAKKLI 205
            :|..:.:.:|.||.:||..:|||||||.::||.|:...:.::.:|||||::||:.||||
plant   159 AIHENILYLRNREADMRTMSEKTNSRVAWYSIMSLGVCIAVSGFQVLYLKQYFEKKKLI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 51/182 (28%)
AT1G09580NP_172429.1 EMP24_GP25L 30..212 CDD:395878 51/182 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 100 1.000 Domainoid score I2346
eggNOG 1 0.900 - - E1_KOG1691
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4972
Inparanoid 1 1.050 108 1.000 Inparanoid score I2089
OMA 1 1.010 - - QHG53581
OrthoDB 1 1.010 - - D1370889at2759
OrthoFinder 1 1.000 - - FOG0001316
OrthoInspector 1 1.000 - - otm2831
orthoMCL 1 0.900 - - OOG6_101611
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.