DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and tmed10

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001016258.1 Gene:tmed10 / 549012 XenbaseID:XB-GENE-968508 Length:207 Species:Xenopus tropicalis


Alignment Length:209 Identity:122/209 - (58%)
Similarity:153/209 - (73%) Gaps:5/209 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARAAFIVCLLMACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDV--PGQIIDYIARD 63
            |||...::..|:.|.: ...:.|.|.||::|||:|:|..|.||.||:|:|:.  .||:...|. |
 Frog     1 MARLLPVLFALLFCGY-VQPISFSLPPNSRKCLREEIHKNVLVTGEYELSEAHNQGQVRLKIT-D 63

  Fly    64 TKGHILSQKEHITKGKFSFMSEVYDTYEICFISKVPAHQ-RGVIQEVSLLTKKGVETKSYEGIGE 127
            :.||||..||..:||||:|.:|.||.:|:||.||:||.. |...|.|:|:.|.|||.|:||.|.:
 Frog    64 SAGHILYSKEDASKGKFAFTTEEYDMFEVCFDSKLPAGAGRVPDQMVNLIMKHGVEAKNYEEIAK 128

  Fly   128 ASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCLLGLATWQV 192
            ..|||||||:|:||||||:|||.||..|:|||||||||||.||.|||:|||||||||:|||||||
 Frog   129 VEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNVRVLYFSIFSMCCLMGLATWQV 193

  Fly   193 LYLRRYFKAKKLIE 206
            .||||:||||||||
 Frog   194 FYLRRFFKAKKLIE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 109/182 (60%)
tmed10NP_001016258.1 EMP24_GP25L 19..201 CDD:366467 109/182 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 206 1.000 Domainoid score I2839
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4972
Inparanoid 1 1.050 220 1.000 Inparanoid score I3462
OMA 1 1.010 - - QHG53581
OrthoDB 1 1.010 - - D1370889at2759
OrthoFinder 1 1.000 - - FOG0001316
OrthoInspector 1 1.000 - - otm48454
Panther 1 1.100 - - LDO PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.080

Return to query results.
Submit another query.