DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and tmed4

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001015779.1 Gene:tmed4 / 548496 XenbaseID:XB-GENE-941602 Length:214 Species:Xenopus tropicalis


Alignment Length:202 Identity:54/202 - (26%)
Similarity:102/202 - (50%) Gaps:15/202 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SHAVMFKLSPNTQKCLKEDIQANQLVMGEFE-----------VSDVPGQIIDYIARDTKGHILSQ 71
            |..:.|.:....::|..|:|....:|:|.::           :...||..:....:|:.|.::..
 Frog    14 SRGLYFHIGETEKRCFIEEIPDETMVIGNYKTQLWDKQSETFLPSTPGLGMHVEVKDSDGKVILS 78

  Fly    72 KEHITKGKFSFMSEVYDTYEICFIS---KVPAHQRGVIQEVSLLTKKGVETKSYEGIGEASKLKP 133
            :::.::|:|:|.|.....::||..|   ::.....|.:: |.|..:.|..|.:|..|....||..
 Frog    79 RQYGSEGRFTFTSHTPGEHQICLHSNSTRMSFFAGGKLR-VHLDIQIGEHTNNYPEIAAKDKLTE 142

  Fly   134 LEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCLLGLATWQVLYLRRY 198
            |::.:::|.|..:.|.::....|.|||..|.|:|.||.|||::||.....|:....||:.:|:.:
 Frog   143 LQLRVRQLLDQVEQIQKEQNYQRYREERFRLTSESTNQRVLWWSIAQTLILILTGIWQMRHLKSF 207

  Fly   199 FKAKKLI 205
            |:||||:
 Frog   208 FEAKKLV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 48/193 (25%)
tmed4NP_001015779.1 EMP24_GP25L 16..209 CDD:307313 48/193 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.