DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and tmed9

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001011147.1 Gene:tmed9 / 496564 XenbaseID:XB-GENE-944838 Length:217 Species:Xenopus tropicalis


Alignment Length:216 Identity:57/216 - (26%)
Similarity:106/216 - (49%) Gaps:15/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AAFIVCLLMACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDVPGQIIDYI-------- 60
            |..::.||.||...:.::.|.:....:||..|:|....:|:|.:.......|..||:        
 Frog     3 AGGVLLLLAACFGPAFSLYFHIGETEKKCFIEEIPDETMVVGNYRTQMFDKQREDYLPATPGLGM 67

  Fly    61 ---ARDTKGHILSQKEHITKGKFSFMSEVYDTYEICFIS---KVPAHQRGVIQEVSLLTKKGVET 119
               .:|....::..:::.::|:|:|.|.....::||..|   |......|::: |.|..:.|...
 Frog    68 FVEVKDPDDKVILSRQYGSEGRFTFTSHTPGEHQICLHSNSTKFALFAGGMLR-VHLDIQVGEHA 131

  Fly   120 KSYEGIGEASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCL 184
            ..|..|....||..|::.:::|.:..:.|.::....|.|||..|.|:|.|:.|||::||.....|
 Frog   132 NDYVDIAAKDKLNTLQLRVRQLIEQVEQIQKEQNYQRWREERFRQTSESTSQRVLWWSIAQTLIL 196

  Fly   185 LGLATWQVLYLRRYFKAKKLI 205
            :.:..||:.:|:.:|:||||:
 Frog   197 VTIGVWQMKHLKGFFEAKKLV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 47/193 (24%)
tmed9NP_001011147.1 EMP24_GP25L 19..212 CDD:366467 47/193 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.