DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and tmed10l

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001007925.1 Gene:tmed10l / 493305 XenbaseID:XB-GENE-5756691 Length:206 Species:Xenopus tropicalis


Alignment Length:201 Identity:108/201 - (53%)
Similarity:139/201 - (69%) Gaps:4/201 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVCLLMACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDVPGQIIDYIARDTKGHILSQ 71
            :.|.|:.   .:.|:.|.|.|..:|||||:|..:.||.||:|||:.||...|....|:.||||..
 Frog     9 VPCFLLP---GTGAISFYLRPLGKKCLKEEIHKDVLVTGEYEVSEQPGLTCDLKVTDSIGHILYS 70

  Fly    72 KEHITKGKFSFMSEVYDTYEICFISKVPAHQRGVI-QEVSLLTKKGVETKSYEGIGEASKLKPLE 135
            ||...||||:|.::..|.||:||:||.|:...... |.::|..|.|||.|:|:.:.|..||||||
 Frog    71 KEDARKGKFAFTTDDNDVYEVCFVSKSPSDTLSFTDQLIALDIKHGVEAKNYKDVAETEKLKPLE 135

  Fly   136 VDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCLLGLATWQVLYLRRYFK 200
            |:|:|||||:.|:|:||..|:|||||||||||.|:.|||:||.|||.||:.||||||.|||.:||
 Frog   136 VELRRLEDLTQSVVKDFSYMKKREEEMRDTNESTSLRVLYFSAFSMFCLVALATWQVFYLRHFFK 200

  Fly   201 AKKLIE 206
            ||||||
 Frog   201 AKKLIE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 98/180 (54%)
tmed10lNP_001007925.1 EMP24_GP25L 19..200 CDD:366467 98/180 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 206 1.000 Domainoid score I2839
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3462
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1370889at2759
OrthoFinder 1 1.000 - - FOG0001316
OrthoInspector 1 1.000 - - otm48454
Panther 1 1.100 - - O PTHR22811
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.