DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and eca

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster


Alignment Length:213 Identity:60/213 - (28%)
Similarity:102/213 - (47%) Gaps:17/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AFIVCLL-MACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEVS-----------DVPGQII 57
            |.|:|:| .||     .:.|.:|...:||..|::.....|:..::|.           ..||..:
  Fly     9 ALILCVLHSAC-----GLYFHISETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGM 68

  Fly    58 DYIARDTKGHILSQKEHITKGKFSFMSEVYDTYEICFISKVPAHQRGVIQEVSLLTKKGVETKSY 122
            ....||:...|:..:.:.::|:.||.|.....:.||..|...|...|....|.|..:.|.....|
  Fly    69 HVEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQVGEHAIDY 133

  Fly   123 EGIGEASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCLLGL 187
            ..:.:..||..|::.:::|.|..:.|.::....|.|||..|.|:|.||||||::|:.....|:.:
  Fly   134 AHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCM 198

  Fly   188 ATWQVLYLRRYFKAKKLI 205
            ..||:.:|:.:|:||||:
  Fly   199 GFWQMRHLKSFFEAKKLV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 49/190 (26%)
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 49/190 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454820
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2831
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
54.940

Return to query results.
Submit another query.