DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and loj

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_648027.3 Gene:loj / 38698 FlyBaseID:FBgn0061492 Length:237 Species:Drosophila melanogaster


Alignment Length:223 Identity:38/223 - (17%)
Similarity:80/223 - (35%) Gaps:34/223 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AFIVCLLMACAWSSH-------------AVMFK--LSPNTQKCLKEDIQANQLVMGEFEVSDVPG 54
            |.|.|.|:....|:.             |:.:|  :....:.|..:.::|.......|.|.....
  Fly    17 ALICCCLLIDVTSAQEAQQPWYENLPAVAMDYKVHIDAGKEDCYHQYVKAGATFYVSFSVVRGGD 81

  Fly    55 QIIDYIARDTKGHILSQKEHITKGKFSFMSEVYDTYEICFISKVPAHQRGVIQEVSLLTKKGVET 119
            .:..:..|:..|.::...:......::........|.:| |....:...|.:..:.:...|....
  Fly    82 GMAGFAVRNPAGEVVKPYQWQATADYTDQVSPGGYYSVC-IDNQFSRFAGKLVNIYITVVKYDAW 145

  Fly   120 KSYEGIGEASKLKPLEVDLKRLEDLSDSIVRDFVLM-----RKREEEMRD-----TNEKTNSRVL 174
            ..|     |.:::.|:::::.......::.|:...|     ..|..|.||     .|   |:.:.
  Fly   146 DKY-----AKEIEQLQLNMQNFTATVGTVERNINDMMGYQAHSRHRESRDYALLLDN---NAYIQ 202

  Fly   175 FFSIFSMCCLLGLATWQVLYLRRYFKAK 202
            .|||..:..:|...:.||.::|:.|:.|
  Fly   203 TFSISQIVVILITCSVQVFFVRKLFEVK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 31/191 (16%)
lojNP_648027.3 EMP24_GP25L 47..228 CDD:279450 30/189 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.