DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and CG9308

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_611629.1 Gene:CG9308 / 37507 FlyBaseID:FBgn0034681 Length:203 Species:Drosophila melanogaster


Alignment Length:224 Identity:47/224 - (20%)
Similarity:90/224 - (40%) Gaps:40/224 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARAAFIVCLLM--ACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEV-----SDVPGQIID 58
            |..|..:|.:|.  ||.:     :..|..:...|..:....:..|...|||     .||..:|..
  Fly     1 MLSAIVLVLVLFQAACGF-----IVTLDAHETMCFYDHANVSDKVTVSFEVMEGGFKDVGVEIAG 60

  Fly    59 YIARDTKGHILSQKEHITKGKFSFMSEVYDTYEICFISKVPAHQRGVIQEVSLLTKKGV-----E 118
              ..|.:.|...|.   |.|.|:|.:.....|::||.:|           :|.:|.|.:     .
  Fly    61 --PDDDRLHHSKQD---TMGSFTFTAMKEGRYQLCFDNK-----------MSTMTPKILMFQFHV 109

  Fly   119 TKSYEGIGEASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMR-------DTNEKTNSRVLFF 176
            .::.|...::||.....::...::.:.:.:......::..:|.|.       :.::....|||.:
  Fly   110 ARAIEFYMDSSKRVDDVIEQATVQSMINQLSAKLGAVKMEQEYMHFRYRGHLEVSDMVELRVLAW 174

  Fly   177 SIFSMCCLLGLATWQVLYLRRYFKAKKLI 205
            |||....|:..|..:|.||:.:|:.|:::
  Fly   175 SIFGPMMLIITAVLEVYYLKHFFEVKRVV 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 39/196 (20%)
CG9308NP_611629.1 EMP24_GP25L 17..198 CDD:279450 39/201 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454829
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.