DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and CG31787

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_724105.1 Gene:CG31787 / 318941 FlyBaseID:FBgn0051787 Length:232 Species:Drosophila melanogaster


Alignment Length:193 Identity:41/193 - (21%)
Similarity:75/193 - (38%) Gaps:36/193 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QKCLKEDIQANQLVMGEFEVSDVPGQI----IDYIARDTKGHILSQKEHITKGKFSFMSEVYDTY 90
            |:|..:.|...:.:..:::|  :.|.:    |::...|....:|..:.....||.|..:....:|
  Fly    40 QECFYQPIATTENIKIDYQV--IHGGLGETHINFNLMDPSRRLLIAETKRQMGKHSIQANETGSY 102

  Fly    91 EICFISKVPAHQRGVIQ---EVSLLTKKGVETK--------------SYEGIGEASKLKPLEVDL 138
            :.||.:.:....:.::.   ||:...::..|.:              :|.||.  |.:..:.|:|
  Fly   103 KFCFDNTISTFNQKIVSFTLEVAPADREERELRDLRQEMLTDYHFDVAYTGID--SYVGKIHVNL 165

  Fly   139 KRLEDLSDSIVRDFVLMRKREEEMRDTN--EKTNSRVLFFSIFSMCCLLGLATWQVLYLRRYF 199
            .|.....|.|         |..|.||.|  |.|.|.|..:|......::.:...|||.:|..|
  Fly   166 MRSRQTQDFI---------RAIEARDRNVAESTYSMVNKWSWAQFLSMIFVGFLQVLMVRSIF 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 41/193 (21%)
CG31787NP_724105.1 EMP24_GP25L 30..220 CDD:279450 41/193 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454841
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.