DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and CHOp24

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster


Alignment Length:222 Identity:59/222 - (26%)
Similarity:103/222 - (46%) Gaps:35/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARAAFIVCLLMACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDVPGQIIDYIARDTK 65
            :|:...:|..|:....:|||.:..:..:.::|..|:::........|||.|  |..:|.   |.|
  Fly     5 LAKVLLLVGSLLILCRTSHAFIVSVDAHNEECFFENVEGGTKFGVTFEVID--GGFLDV---DIK 64

  Fly    66 -----GHILSQKEHITKGKFSFMSEVYDTYEICFISKVPAHQRGVIQEVSLLTKKGVETKSYEGI 125
                 .|::.:.|..:.||::|::....||.:||.:           |.|.:|.|.|....  .:
  Fly    65 ISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNN-----------ERSSMTPKLVMFSI--DV 116

  Fly   126 GEASKLKP-----LEVDLKRLEDL-------SDSIVRDFVLMRKREEEMRDTNEKTNSRVLFFSI 178
            |:|.:..|     .||...:|||:       ..|:..:...|..|::..|..||.|||||:.:|.
  Fly   117 GDAPQRAPGAPGEEEVGHTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWST 181

  Fly   179 FSMCCLLGLATWQVLYLRRYFKAKKLI 205
            |....|:.:...||.||:|:|:.|:::
  Fly   182 FEALVLVLMTVGQVYYLKRFFEVKRVV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 52/196 (27%)
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 52/196 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.