DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and SPBC16E9.09c

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_595791.1 Gene:SPBC16E9.09c / 2540028 PomBaseID:SPBC16E9.09c Length:215 Species:Schizosaccharomyces pombe


Alignment Length:223 Identity:48/223 - (21%)
Similarity:88/223 - (39%) Gaps:43/223 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLMACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDVPGQIIDYIARD----------- 63
            ||....:.|.||.|....:..||..:|:....:|.|..:......:...::..:           
pombe     9 LLFTFFFQSQAVHFYFDGSKPKCFLKDMPKGMMVTGIVKAEQWNNEANKWVTSNNIKIRVQVDET 73

  Fly    64 -TKGHILSQKEHITKGKFSFMSEVYDTYEICFISKVPAHQRGVIQEVSLLTKKG-----VETKSY 122
             ...|::.:.:..:.....|.:....|:.||::|                |..|     .:|:.:
pombe    74 FANNHLIYKNDLRSNEAVRFTTTNEGTHRICYLS----------------TSDGAWFSSTKTRLH 122

  Fly   123 EGIGEASKLKPLEVDLKRLEDLSD----------SIVRDFVLMRKREEEMRDTNEKTNSRVLFFS 177
            ..:....|...:.......:||:|          ||:.:.:|.|.||...|||:|..||||:.::
pombe   123 VDLASDDKYNLIASSEDEAKDLTDRVAALNTRLESILGEQMLQRSREMTFRDTSESANSRVVRWT 187

  Fly   178 IFSMCCLLGLATWQVLYLRRYFKAKKLI 205
            |..:..||....||:.:|:|:|..:||:
pombe   188 IVQIVVLLVTCIWQLSHLQRFFVKEKLV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 42/206 (20%)
SPBC16E9.09cNP_595791.1 EMP24_GP25L 19..209 CDD:279450 42/205 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.