DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and TMED3

DIOPT Version :10

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_031390.1 Gene:TMED3 / 23423 HGNCID:28889 Length:217 Species:Homo sapiens


Alignment Length:214 Identity:42/214 - (19%)
Similarity:87/214 - (40%) Gaps:20/214 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RAAFIVCLLMACAWSSH----AVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDVPGQIIDYIARD 63
            |:|.::.||:....:..    .:.|:|..|.::|..|:::.......:::|.......:|....|
Human     7 RSASVLLLLLLLRRAEQPCGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVED 71

  Fly    64 TKGHILSQKEHITKGKFSFMSEVYDTYEICFISKVPAHQRGVI-------QEVSLLTKKGVETKS 121
            .:|:.:.::.......|::.:||...|:.||.::........:       .|..:|...|     
Human    72 PQGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMG----- 131

  Fly   122 YEGIGEASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCLLG 186
                ...:.|..:|.....:.:...:::......|.||.:.|...|..||||.::|:.....|..
Human   132 ----NRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFV 192

  Fly   187 LATWQVLYLRRYFKAKKLI 205
            ::..|||.|:.:|..|:.|
Human   193 VSFSQVLLLKSFFTEKRPI 211

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:426051 35/186 (19%)
TMED3NP_031390.1 EMP24_GP25L 28..205 CDD:426051 35/185 (19%)
COPI vesicle coat-binding. /evidence=ECO:0000255 204..217 3/8 (38%)