DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and tmed-12

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_508054.1 Gene:tmed-12 / 188279 WormBaseID:WBGene00011606 Length:167 Species:Caenorhabditis elegans


Alignment Length:172 Identity:40/172 - (23%)
Similarity:72/172 - (41%) Gaps:20/172 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVCLLMACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEV----------SDVPGQIIDYIA 61
            ::..|::.|..:.::.|.::...:||..|:|....:|.|.::|          .|.|...:....
 Worm     3 LLIALLSLATYADSLYFHIAETEKKCFIEEIPDETMVTGNYKVQLYDPNTKGYGDYPNIGMHVEV 67

  Fly    62 RDTKGHILSQKEHITKGKFSFMSEVYDTYEICFISKVPAHQRGVIQEVSLLTKKGVETKSYEGIG 126
            :|.:..::..|.:.::|:|:|.|.....:.||..|...|...|....|.|..:.|...:.|..:.
 Worm    68 KDPEDKVILSKLYTSEGRFTFTSNTPGEHVICIYSNTTAWFNGAQLRVHLDIQAGDHAQDYAQVE 132

  Fly   127 EASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEK 168
            |..||     |..|.:.|.:   .||.|  |.:|.....:||
 Worm   133 EERKL-----DENREKSLEN---EDFRL--KIDENRGKCSEK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 38/159 (24%)
tmed-12NP_508054.1 EMP24_GP25L 16..>158 CDD:366467 36/151 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.