DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and TMED10

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_006818.3 Gene:TMED10 / 10972 HGNCID:16998 Length:219 Species:Homo sapiens


Alignment Length:195 Identity:112/195 - (57%)
Similarity:139/195 - (71%) Gaps:14/195 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDV---PGQIIDYI-ARDTKGHILSQKEHITKGKF 80
            |:.|.|..|::|||:|:|..:.||.|.:|:||.   .|.:..:: ..|:.||||..||..|||||
Human    31 AISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKF 95

  Fly    81 SFMSEVYDTYEICFISK----VPAHQRGVIQEVSLLTKKGVETKSYEGIGEASKLKPLEVDLKRL 141
            :|.:|.||.:|:||.||    :|.      |.|.|..|.|||.|:||.|.:..|||||||:|:||
Human    96 AFTTEDYDMFEVCFESKGTGRIPD------QLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRL 154

  Fly   142 EDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCLLGLATWQVLYLRRYFKAKKLIE 206
            ||||:|||.||..|:|||||||||||.||:|||:||||||.||:|||||||.||||:||||||||
Human   155 EDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE 219

  Fly   207  206
            Human   220  219

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 104/187 (56%)
TMED10NP_006818.3 Required for interaction with STX17. /evidence=ECO:0000269|PubMed:21545355 1..142 49/116 (42%)
EMP24_GP25L 31..213 CDD:395878 104/187 (56%)
Required for TMED10 and TMED2 cis-Golgi network localization 147..178 23/30 (77%)
Interaction with COPG1 204..219 12/14 (86%)
Interaction with ARF1 and IL1B. /evidence=ECO:0000269|PubMed:11726511, ECO:0000269|PubMed:32272059 207..219 10/11 (91%)
COPI vesicle coat-binding 211..219 6/7 (86%)