DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and si:ch211-255i20.3

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_003199913.2 Gene:si:ch211-255i20.3 / 100535182 ZFINID:ZDB-GENE-141216-113 Length:220 Species:Danio rerio


Alignment Length:215 Identity:59/215 - (27%)
Similarity:95/215 - (44%) Gaps:24/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AAFIVCLLMACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEV--------SDVPGQIIDYI 60
            |:|::.        :.|:.|.|....:||:.|:|..:.||.|.|.:        |:.|...:...
Zfish    17 ASFVIL--------ASAMYFDLGEQEEKCIIEEIPVDTLVTGVFRLEYWDENKKSNTPQLGLTVT 73

  Fly    61 ARDTKGHILSQKEHITKGKFSFMSEVYDTYEICFIS-----KVPAHQRGVIQEVSLLTKKGVETK 120
            .||.:..::..|.....|||:|.|.....:.:|..|     .|.|..|   .:|.|..:.|..|.
Zfish    74 VRDPQHEVVLLKRFGRYGKFTFTSPASGQHFLCMQSNSTRFSVFAGDR---LKVHLDVQMGEHTI 135

  Fly   121 SYEGIGEASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCLL 185
            ..........:|.:|.:|:.|.|....|.|.....|:|||:.|..:|:||..||:::|.....||
Zfish   136 DPNAAKTKDTIKAMEYNLQHLIDQMRYISRQQDFQREREEKFRQMSEETNGNVLWWAIIQTSILL 200

  Fly   186 GLATWQVLYLRRYFKAKKLI 205
            .:..||:..|:.:|..|||:
Zfish   201 SVGFWQMKNLKDFFIEKKLV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 53/192 (28%)
si:ch211-255i20.3XP_003199913.2 EMP24_GP25L 25..214 CDD:279450 53/191 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.