DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and Tmed10-ps

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_036014158.1 Gene:Tmed10-ps / 100042773 MGIID:3782198 Length:219 Species:Mus musculus


Alignment Length:216 Identity:115/216 - (53%)
Similarity:146/216 - (67%) Gaps:25/216 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AAFIVCLLMACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDVPG---------QIIDY 59
            :|::..||:..: |...:.|.|..|::|||:|:|..:.||.|.:|::|..|         :|   
Mouse    16 SAWLFLLLLGPS-SVLGISFHLPVNSRKCLREEIHKDLLVTGAYEITDQSGGAGGLRPHLKI--- 76

  Fly    60 IARDTKGHILSQKEHITKGKFSFMSEVYDTYEICFISK----VPAHQRGVIQEVSLLTKKGVETK 120
              .|:.||||..||..|||||:|.:|.||.:|:||.||    :|.      |.|.|..|.|||.|
Mouse    77 --TDSAGHILYAKEDATKGKFAFTTEDYDMFEVCFESKGTGQIPD------QLVILDMKHGVEAK 133

  Fly   121 SYEGIGEASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRVLFFSIFSMCCLL 185
            :||.|.:..|||||||:|:||||||:|||.||..|:|||||||||||.||:|||:||||||.||:
Mouse   134 NYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLI 198

  Fly   186 GLATWQVLYLRRYFKAKKLIE 206
            |||||||.||||:||||||||
Mouse   199 GLATWQVFYLRRFFKAKKLIE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 103/192 (54%)
Tmed10-psXP_036014158.1 EMP24_GP25L 31..213 CDD:395878 103/192 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4972
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.