DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smg6 and SWT1

DIOPT Version :9

Sequence 1:NP_651321.1 Gene:Smg6 / 42994 FlyBaseID:FBgn0039260 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_014809.3 Gene:SWT1 / 854337 SGDID:S000005692 Length:458 Species:Saccharomyces cerevisiae


Alignment Length:363 Identity:81/363 - (22%)
Similarity:137/363 - (37%) Gaps:97/363 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   622 LLDEDVAL-RGFTPLGRETLSMDYLKRGSERLQFFERVRRIGQFQEYYVQHQEALQQPLESSFTV 685
            :.||..|. :|...:..||.:.....:.||.::....:|..|   :|.||..:.:     .:.|.
Yeast     1 MTDEKRAFPKGNNHIRSETFNGSVSHKISESIKDIASLRPHG---KYTVQDIDNI-----IASTS 57

  Fly   686 EHLNAAM---KNALENYDAES----CGLAANVSKIQCKAVEELLCRSTDSDV---SELCKLKKEL 740
            .|.|...   .|...|:|.|.    |.|                  :.:|||   ||....::|:
Yeast    58 SHENRGQSGDSNGCINHDEEGDIPMCDL------------------NDESDVEMISEYLSSQREM 104

  Fly   741 EAKARVKQICTSKLEDILKFVDTKIYIEVRPRYLLPDTNCFIDCLEDFEKLSTEFKRY--TLIIP 803
            ||::....:  .|:.|.|..::..   .::..::: |||..|..|...|||.:....|  .:|:|
Yeast   105 EAQSVANYM--PKINDDLPLLNPP---TLKTAFVV-DTNFIISHLNTLEKLRSLSSTYHHLIIVP 163

  Fly   804 LTVVKELDGLSKGVKLDSYRSSKQTQRIHHFDEVSSRAKKSLEFIKSAKGN---------VKCAT 859
            .||::|||||.|..  |..|.:..|....|...:.:.|:...::|.....|         :|.:.
Yeast   164 TTVIQELDGLKKSP--DIARDNDDTTNQEHDRTIGTLARWGNDWIYKNLANLDSGLIGQKLKQSL 226

  Fly   860 TKGSFVNASVFALVEEEYLSNDDKILATAMAVSKTAKTEQCTDGKCFIQTELVLITTDRNLRVKA 924
            ..||.               .||.||...:...:..        .||:    :|::.|:||..||
Yeast   227 NPGSL---------------KDDSILDCCLYFKEIL--------NCFV----ILLSNDKNLCTKA 264

  Fly   925 LSRN--------------LAVSALDEFLQWAKDCREST 948
            |:.:              :|:.|.:|......:.|:||
Yeast   265 LTEDILTVSFRKNMDAKIIAMRAYEENQLRFANLRDST 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smg6NP_651321.1 EST1 190..298 CDD:287360
EST1_DNA_bind 310..638 CDD:287359 4/16 (25%)
P-loop_NTPase <616..>769 CDD:304359 33/157 (21%)
PIN_Smg6 767..941 CDD:189055 45/198 (23%)
SWT1NP_014809.3 PIN_Swt1-like 133..280 CDD:350294 42/176 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1427
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.