DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smg6 and SWT1

DIOPT Version :9

Sequence 1:NP_651321.1 Gene:Smg6 / 42994 FlyBaseID:FBgn0039260 Length:948 Species:Drosophila melanogaster
Sequence 2:XP_005245328.1 Gene:SWT1 / 54823 HGNCID:16785 Length:907 Species:Homo sapiens


Alignment Length:644 Identity:129/644 - (20%)
Similarity:234/644 - (36%) Gaps:214/644 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 SLLTSNSIQSAKESLLDLFDEIRRKYEETEMKQSPMHYAAGSKNQKSKQMRKEVWIYPDGIRRLH 415
            |..:|:||:|...      ::.:.|.:.|::    ::|     |.|.:|..|.:.:..|.:||..
Human    38 SSTSSSSIRSVSS------EKRKLKSDHTDV----LYY-----NIKRRQGLKRLSVEIDTLRRRP 87

  Fly   416 RTDDKGNK------------------AKGNKATMAEVNRYEEMPPEEILPRIVSLYLYLLGKL-Y 461
            :......:                  :..:..|..::::..:..|::|             || .
Human    88 KIGSSSQRPIKLKEASYSNDNQIILQSPSSNGTKKDIHKCVDFKPKDI-------------KLTN 139

  Fly   462 TGTDVDSLYPLLRKLQIQIGVALRHENLLSRSKLLKIVALNLFVVEHNKPKTSRREMRYHSFNFA 526
            .|:.:|.....|...:|...|..:.|...|.:|...:      :|:..|.|..::. |...|...
Human   140 AGSKLDHGIKSLSSPKIASDVKPKAEGQASENKWSHL------LVQREKMKELKKG-RNSKFRDN 197

  Fly   527 NSFFGLMMKKTNQLLAGFVEDSTNVQCLPEEDFATVNTYLQFVNVYVRWLSISLDVWEPVRS--- 588
            :....|...|.||    |.:|..:.:.:.|.             :..|...||..:  |::|   
Human   198 SEKCVLEKWKRNQ----FSQDYNSNKIIKEP-------------LGSRRQKISFKI--PIKSRDT 243

  Fly   589 -----EEHSFIDCWAELTILFEYIECLMGKHKLEKNEILLDEDVALRGFTPLGRETLSMDYLKRG 648
                 ||:.|            .|:....|.|.|:.|.|....|:| ..|....|.|..|:..: 
Human   244 LQKLVEENVF------------NIDSNNSKTKQEEREYLESSQVSL-NVTRQKTEHLLSDFTYK- 294

  Fly   649 SERLQFFERVRRIGQF-QEYYVQHQEALQQPLESSFTVEHLNAAMKNALENYDAESCGLAANVSK 712
                      |.:.:: ::::..|||:     ..|.:.|:|.       ::::|..|.:::  ..
Human   295 ----------RTVHEWKRKHHYDHQES-----NDSHSRENLT-------QSFEAPCCSVSS--ES 335

  Fly   713 IQ-----CKAVEELLCRSTDSDV---SELCKLKKELE----AKARVKQICTSKLEDILKFVDTKI 765
            ||     .:.||||........|   .||..::.:||    :.:.:..:..|.     ...|.|:
Human   336 IQDADQEMQIVEELHAARVGKSVDLPGELMSMEIDLEDDVHSSSGIPYMLMSN-----NTSDRKL 395

  Fly   766 YIEVRPRYLLPDTNCFIDCLEDFEKLSTE----FKRYTLIIPLTVVKELDGLSKGVKLDSYRSSK 826
            .|.:       |||..::.|:....|.|.    |.:..||||..|::|||.:.:|         |
Human   396 LIVI-------DTNILMNHLKFVRILKTTEVPGFDKLVLIIPWVVMQELDRMKEG---------K 444

  Fly   827 QTQRIHHFDEVSSRAKKSLEFIKSAKGN---------VKCATTKGSFVNASVFALVEEEYLSNDD 882
            ..:|..|      :|..::.||..:..|         ::.|:.|.       :.|.:|   :|||
Human   445 LLKRAQH------KAIPAVHFINDSLKNQDRKLWGQSIQLASQKH-------YGLSDE---NNDD 493

  Fly   883 KILATAMAVSKTAKTEQCTDGKCFIQTE-------LVLITTDRNLR-------VKALSR 927
            ::|                  ||.:|.:       ::|.|.|||||       ||:||:
Human   494 RVL------------------KCCLQHQELFPCSFVILCTDDRNLRNKGLISGVKSLSK 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smg6NP_651321.1 EST1 190..298 CDD:287360
EST1_DNA_bind 310..638 CDD:287359 57/313 (18%)
P-loop_NTPase <616..>769 CDD:304359 33/165 (20%)
PIN_Smg6 767..941 CDD:189055 46/188 (24%)
SWT1XP_005245328.1 PIN_Smg5-Smg6-like 396..537 CDD:189050 46/189 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1427
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.