DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smg6 and CG7206

DIOPT Version :9

Sequence 1:NP_651321.1 Gene:Smg6 / 42994 FlyBaseID:FBgn0039260 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_996499.1 Gene:CG7206 / 32788 FlyBaseID:FBgn0030892 Length:404 Species:Drosophila melanogaster


Alignment Length:355 Identity:85/355 - (23%)
Similarity:135/355 - (38%) Gaps:91/355 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   617 EKNEILLDEDVALRGFTPLGRETLSMDYLKRGSERLQFFERVRR--IGQFQEYYVQHQ-EALQQP 678
            ||.:.|:|.:....|.|....:.|.:  |:...::.|.:|....  :.:..|..::.| ||....
  Fly   102 EKPKALVDANRLKAGRTQTAYQRLML--LRASLQQKQLYEERNNNIVAKINEEVIEKQPEACNIT 164

  Fly   679 LESSF---TVEHLNAAMKNALENYDAESCGLAANVSKIQCKAVEELLCRSTDSDVSELCKLKKEL 740
            ..|:|   |...:........|:.:.|    ||...:.:.|..::.|.......:.|....|.:.
  Fly   165 NPSAFDGSTASDMEVEPMEWQESIEEE----AAQNDQDEAKKGDDTLLMLPAESIEEEAPQKGQD 225

  Fly   741 EAKARVKQICTSKLEDILKFVDTKIYIEVRPR-----YLLPDTNCFIDCLEDFEKLSTEFKRYT- 799
            |||.....|.      :|:..|.:   |:.||     |.:.|||..|...:..|:|:......| 
  Fly   226 EAKEEDDTIL------MLQAADAE---ELPPRLEDYMYFVLDTNVLIHNHKFVERLTDVVLPGTV 281

  Fly   800 ---LIIPLTVVKELDGLSKGVKLDSYRSSKQTQRIHHFDEVSSRAKKSLEFIKSAKGNVKCATTK 861
               |.:|..|:||||      ||.|...|...||:     ::.||             ::...||
  Fly   282 GSMLYLPYIVIKELD------KLKSKYQSDCLQRV-----IAMRA-------------IRFLNTK 322

  Fly   862 --GSFVNASVFALVEEEYLSN----DDKILATAMAVSKTAKTEQCTDGKCFIQTE-----LVLIT 915
              .||...:..||.|.::|..    ||.||                  .|.:|.:     ::|:|
  Fly   323 FDESFQIQAQSALEEADHLIKIDCPDDSIL------------------NCCLQLQAQVPHMILLT 369

  Fly   916 TDRNLRVKALSRNLAVSA--------LDEF 937
            .|.|||:||.:.|:.||.        :|||
  Fly   370 NDANLRLKANASNIQVSCRSDLMSTYVDEF 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smg6NP_651321.1 EST1 190..298 CDD:287360
EST1_DNA_bind 310..638 CDD:287359 6/20 (30%)
P-loop_NTPase <616..>769 CDD:304359 31/157 (20%)
PIN_Smg6 767..941 CDD:189055 54/199 (27%)
CG7206NP_996499.1 PIN_Smg5-Smg6-like 254..392 CDD:189050 48/179 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1427
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.