DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smg6 and est1

DIOPT Version :9

Sequence 1:NP_651321.1 Gene:Smg6 / 42994 FlyBaseID:FBgn0039260 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_596232.1 Gene:est1 / 2540492 PomBaseID:SPBC2D10.13 Length:490 Species:Schizosaccharomyces pombe


Alignment Length:249 Identity:53/249 - (21%)
Similarity:85/249 - (34%) Gaps:80/249 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 TTEHPD--WFEPLLGLPHAKNIVHLYDQLMVLNQRNLILINWKNFCYIHDQLQDAFKQLLLEQLK 213
            |.|.||  |     ...|.|.|.|...:...::.|::                            
pombe    59 TFERPDIIW-----SCCHYKIIQHFRSRFREIHPRHV---------------------------- 90

  Fly   214 FVCEHKVDVFFWKLL-----FYN--VRNYLKRQQTDQAHTHTLLLIEQAIKFYRMLYDKLMAKCV 271
             |.:.|....|:|.|     ||.  :...:.:.|.|.               ||..:.|..:...
pombe    91 -VEKKKTKKVFFKFLKTCAIFYQTCISELISKFQLDS---------------YRPFFCKWTSSAT 139

  Fly   272 ASSRCDS-----------------ALKVVAQRLLICLGDLTRYRVNHVKATD-YMEAARYYQRAQ 318
            .||...:                 ||:.| ....|.|||:.||....:|... |..|..:|..|.
pombe   140 VSSTISNDEMSSIPEASYSRNHMEALECV-YNCFIYLGDMARYSSTCLKKRGAYDRALGFYDLAH 203

  Fly   319 ELVPGNGAPFNQLAVISIYHHKRFDAVYYYVRSLLTSNSIQSAKESLLDLFDEI 372
            ..:||||...||:||:........:::|::..:|.:.:..:||   ||:|..::
pombe   204 RTLPGNGMHRNQIAVVWASDECIVESIYWFSSALCSEDPPKSA---LLNLLKQL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smg6NP_651321.1 EST1 190..298 CDD:287360 22/131 (17%)
EST1_DNA_bind 310..638 CDD:287359 18/63 (29%)
P-loop_NTPase <616..>769 CDD:304359
PIN_Smg6 767..941 CDD:189055
est1NP_596232.1 EST1 64..184 CDD:287360 30/169 (18%)
EST1_DNA_bind 195..450 CDD:287359 18/63 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2162
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15696
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.