DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and thrb

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:XP_012820319.1 Gene:thrb / 734147 XenbaseID:XB-GENE-6070709 Length:476 Species:Xenopus tropicalis


Alignment Length:95 Identity:43/95 - (45%)
Similarity:61/95 - (64%) Gaps:4/95 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKK---QFTCPFNQNCDITVVTRRFCQKCRLRKCL 68
            |.||||||.||::..:|||.||.|||| .:.|.   .::|.:...|.|..|||..||:||.:||:
 Frog   122 CVVCGDKATGYHYRCITCEGCKGFFRR-TIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCI 185

  Fly    69 DIGMKSENIMSEEDKLIKRRKIETNRAKRR 98
            .:||.::.::.:..:|.||:.||.||.|||
 Frog   186 AVGMATDLVLDDSKRLAKRKLIEENREKRR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 41/93 (44%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
thrbXP_012820319.1 NR_DBD_TR 121..207 CDD:143519 36/85 (42%)
NR_LBD_TR 231..473 CDD:132733
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.