DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and THRB

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_000452.2 Gene:THRB / 7068 HGNCID:11799 Length:461 Species:Homo sapiens


Alignment Length:98 Identity:44/98 - (44%)
Similarity:62/98 - (63%) Gaps:4/98 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKK---QFTCPFNQNCDITVVTRRFCQKCRLRKCL 68
            |.||||||.||::..:|||.||.|||| .:.|.   .::|.:...|.|..|||..||:||.:||:
Human   107 CVVCGDKATGYHYRCITCEGCKGFFRR-TIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCI 170

  Fly    69 DIGMKSENIMSEEDKLIKRRKIETNRAKRRLME 101
            .:||.::.::.:..:|.||:.||.||.|||..|
Human   171 YVGMATDLVLDDSKRLAKRKLIEENREKRRREE 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 41/93 (44%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
THRBNP_000452.2 Modulating 1..106
NR_DBD_TR 106..192 CDD:143519 36/85 (42%)
NR_LBD_TR 216..458 CDD:132733
Interaction with NR2F6. /evidence=ECO:0000269|PubMed:10713182 244..461
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.