DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and Nr1h5

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:XP_003749414.1 Gene:Nr1h5 / 690430 RGDID:1596077 Length:504 Species:Rattus norvegicus


Alignment Length:218 Identity:61/218 - (27%)
Similarity:105/218 - (48%) Gaps:30/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQFTCPFNQNCDITVVTRRFCQKCRLRKCLDIG 71
            |.||||||.||::||:|||.||.||||:......::|....:|::.:..||.|.:|||:||..:|
  Rat   121 CMVCGDKASGYHYNALTCEGCKGFFRRSITKNAVYSCKNGGHCEMDMYMRRKCPECRLKKCKAVG 185

  Fly    72 MKSENIMSEEDKLIKRRKIETNRAKRRLMENGTDACDADGGEERDHKAPADSSSSNLDHYSGSQD 136
            |.:|.:::|..  .|.:::..:...|..:.:.....|    |..|.|..:.:|.|.    .|:||
  Rat   186 MLAECLLTEIQ--CKSKRLRKSFKHRPTLSSAIQVED----EGTDTKHVSSTSRSG----KGAQD 240

  Fly   137 SQSCGSADS---GANGCSGRQASSPGTQVNPLQMTAEKIVDQIVSDPD----RASQA----INRL 190
            ..:..:.:.   .....:.|::..|..:::.|.        |..|:|:    |.|:|    .|.|
  Rat   241 DMTLTAEERRLLNTIVTAHRKSMVPVGEISALL--------QEYSNPELSFLRLSEASILHANWL 297

  Fly   191 MRTQKEAISVMEKVISSQKDALR 213
            |:..| .:...|.:.:..:.||:
  Rat   298 MKFTK-GLPGFENLTAEDQTALQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 35/90 (39%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
Nr1h5XP_003749414.1 NR_DBD_FXR 118..201 CDD:143520 35/81 (43%)
NR_LBD 247..496 CDD:299703 16/82 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24082
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.