DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and RORC

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:XP_006711547.2 Gene:RORC / 6097 HGNCID:10260 Length:651 Species:Homo sapiens


Alignment Length:771 Identity:134/771 - (17%)
Similarity:227/771 - (29%) Gaps:354/771 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQFTCPFNQNCDITVVTRRFCQKCRLRKCLDIG 71
            |.:||||:.|.::..:|||.||.||||:......::|...|||.|...:|..||.|||:|||.:|
Human   164 CKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALG 228

  Fly    72 MKSENI----MSEEDKLIKRRKIETNRAKRRLMEN----GTDACDADGGEE-------RDHKAPA 121
            |..:.:    ||::.:.....:::....:|:..:.    .|....|.|.:.       .|.:.|.
Human   229 MSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPL 293

  Fly   122 DSSSS---------NLDHYSGSQDSQSCGSADSGANGCSGRQASSPGTQVNPLQMTAEKIVDQIV 177
            .||..         .|...|||..|.|...|.:|.||.|                          
Human   294 GSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGAS-------------------------- 332

  Fly   178 SDPDRASQAINRLMRTQKEAISVMEKVISSQKDALRLVSHLIDYPGDALKIISKFMNSPFNALTV 242
                                                                             
Human   333 ----------------------------------------------------------------- 332

  Fly   243 FTKFMSSPTDGVEIISKIVDSPADVVEFMQNLMHSPE-DAIDIMNKFMNTPAEALRILNRILSGG 306
                                         .:|.:||| ...:....|.:|               
Human   333 -----------------------------CHLEYSPERGKAEGRESFYST--------------- 353

  Fly   307 GANAAQQTADRKPLLDKEPAVKPAAPAERADTVIQSMLGNSPPISPHDAAVDLQYHSPGVGEQPS 371
               .:|.|.||..|..:|                                    :..||:||...
Human   354 ---GSQLTPDRCGLRFEE------------------------------------HRHPGLGELGQ 379

  Fly   372 TSSSHPLPYIANSPDFDLKTFMQTNYNDEPSLDSDFSINSIESVLSEVIRIEYQAFNSIQQAASR 436
            ...|:..|...::|:                                   ..|.:...|:     
Human   380 GPDSYGSPSFRSTPE-----------------------------------APYASLTEIE----- 404

  Fly   437 VKEEMSYGTQSTYGGCNSAANNSQPHLQQPICAPSTQQLDRELNEAEQMKLRELRLASEALYDPV 501
                                     ||.|.:|        :...|..|::|.:|......::.  
Human   405 -------------------------HLVQSVC--------KSYRETCQLRLEDLLRQRSNIFS-- 434

  Fly   502 DEDLSALMMGDDRIKPDDTRHNPKLLQLI------NLTAVAIKRLIKMAKKITAFRDMCQEDQVA 560
                          :.:.|.:..|.:..:      :||. ||:.:::.||:::.|.::||.||:.
Human   435 --------------REEVTGYQRKSMWEMWERCAHHLTE-AIQYVVEFAKRLSGFMELCQNDQIV 484

  Fly   561 LLKGGCTEMMIMRSVMIYDDDRAAWKVPHTKENMGNIRTDLLKFAEG------------------ 607
            |||.|..|::::|....|:.|.               ||   .|.||                  
Human   485 LLKAGAMEVVLVRMCRAYNADN---------------RT---VFFEGKYGGMELFRALGCSELIS 531

  Fly   608 NIYE-EHQKFITTFDEKWRMDENIILIMCAIVLFTSAR-----SRVIHKDVIRLEQNSYYYLLRR 666
            :|:: .|......|.|    ||  |.:..|:||..:.|     .|.:.:....||...:::|.:.
Human   532 SIFDFSHSLSALHFSE----DE--IALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKT 590

  Fly   667 YLESVYSGCEARNAFIKLIQKISDVERLNKFIINVYLNVNPSQVE----PLLREIF 718
            :.:|:.:....:.....|..:  .||||     .::.:::|..|:    ||.:|:|
Human   591 HRQSILAKLPPKGKLRSLCSQ--HVERL-----QIFQHLHPIVVQAAFPPLYKELF 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 33/94 (35%)
NR_LBD 462..>573 CDD:299703 26/116 (22%)
NR_LBD_F1 523..702 CDD:132727 46/208 (22%)
RORCXP_006711547.2 NR_DBD_ROR 157..251 CDD:143526 33/86 (38%)
NR_LBD_ROR_like 401..639 CDD:132737 61/323 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.