DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and RARB

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001277145.1 Gene:RARB / 5915 HGNCID:9865 Length:455 Species:Homo sapiens


Alignment Length:425 Identity:106/425 - (24%)
Similarity:173/425 - (40%) Gaps:91/425 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPP---KNCAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQFTCPFNQNCDITVVTRRFCQKC 62
            :.||   |.|.||.||:.||::....||.||.||||:......:||..::||.|..|||..||.|
Human    79 LPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYC 143

  Fly    63 RLRKCLDIGMKSENIMSEEDKLIKRRKIETNRAKRRLMENGTDACDADGGEERDHKAPADS--SS 125
            ||:||.::||..|::.::.:|    :|.||  :|:...|:.....:.|...|:..||..::  |.
Human   144 RLQKCFEVGMSKESVRNDRNK----KKKET--SKQECTESYEMTAELDDLTEKIRKAHQETFPSL 202

  Fly   126 SNLDHYSGSQDSQSCGSADSG--------ANGCSGR----QASSPGTQVNPLQMTAEKIVDQIVS 178
            ..|..|:.:..:......|.|        |..|..:    ....||       .|...|.|||. 
Human   203 CQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPG-------FTGLTIADQIT- 259

  Fly   179 DPDRASQAINRLMRTQKEAISVME--KVISSQKDALRLVSHLIDYPGDALKI-ISKFMNSPFNAL 240
                       |::.....|.::.  ...:.::|.:..        .|.|.: .::..|:.|..|
Human   260 -----------LLKAACLDILILRICTRYTPEQDTMTF--------SDGLTLNRTQMHNAGFGPL 305

  Fly   241 T--VFT---KFMSSPTDGVE--IISKI---------VDSPADVVEFMQNLMHSPEDAIDIMNKFM 289
            |  |||   :.:....|..|  ::|.|         ::.|..|.:..:.|:.:.:  |.|..:..
Human   306 TDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALK--IYIRKRRP 368

  Fly   290 NTPAEALRILNRILSGGGANAAQQTADRKPLLDKE-PAVKPAAPAERADTVIQSMLGNS---PPI 350
            :.|....:||.:|......:|  :.|:|...|..| |...|        .:||.||.||   .|:
Human   369 SKPHMFPKILMKITDLRSISA--KGAERVITLKMEIPGSMP--------PLIQEMLENSEGHEPL 423

  Fly   351 SPHDAAVDLQYHSPGVGEQPSTSSSHPLPYIANSP 385
            :|..:. :...|||.:......:|.     ::.||
Human   424 TPSSSG-NTAEHSPSISPSSVENSG-----VSQSP 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 39/92 (42%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
RARBNP_001277145.1 Modulating 1..87 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..78
NR_DBD_RAR 82..166 CDD:143522 36/87 (41%)
Hinge 154..182 7/33 (21%)
NR_LBD_RAR 186..416 CDD:132735 53/268 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..455 10/44 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157551
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.