DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and Nr1h2

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:XP_038944684.1 Gene:Nr1h2 / 58851 RGDID:61906 Length:446 Species:Rattus norvegicus


Alignment Length:374 Identity:85/374 - (22%)
Similarity:150/374 - (40%) Gaps:130/374 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNAL--AKKQFTCPFNQNCDITVVTRRFCQKCRLRKCLD 69
            |.||||||.|:::|.::||.||.||||:.:  ...::.|..:..|.:....||.||.||||||.:
  Rat    78 CRVCGDKASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQLCRLRKCKE 142

  Fly    70 IGMKSENIMSEEDKLIKRRKIETNRAKRRLMENGTDACDADGGEERDHKAPADSSSSNLDHYSGS 134
            .||:.:.::|||.  |:::||:                                          .
  Rat   143 AGMREQCVLSEEQ--IRKKKIQ------------------------------------------K 163

  Fly   135 QDSQSCGSADSGANGCSGRQASSPGT---------QVNPLQMTA--EKIVDQIVSDPDRASQAIN 188
            |..|........|:|.|.|.|:||||         :...:|:||  |.::.|:|     |:|   
  Rat   164 QQQQQPPPPTEPASGSSARPAASPGTSEASSQGSGEGEGIQLTAAQELMIQQLV-----AAQ--- 220

  Fly   189 RLMRTQKEAISVMEKVI-------SSQKDA----------LRLVS--HLIDY----PG------- 223
              ::..|.:.|...||.       ...:||          |.::|  .::|:    ||       
  Rat   221 --LQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGRE 283

  Fly   224 DALKIISKFMNSPFNALTVFTKFMSSPTDGVEIISKIVDSPADVVEFMQNLMHSPED--AIDIMN 286
            |.:.::        .|.|:....:.:        ::..:...:.:.|:::..:|.:|  ...:..
  Rat   284 DQIALL--------KASTIEIMLLET--------ARRYNHETECITFLKDFTYSKDDFHRAGLQV 332

  Fly   287 KFMNTPAEALRILNRILSGGGANAAQQ---------TADRKPLLDKEPA 326
            :|:|...|..|.:.|:    |.:.|:.         :|||..:  :||:
  Rat   333 EFINPIFEFSRAMRRL----GLDDAEYALLIAINIFSADRPNV--QEPS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 37/92 (40%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
Nr1h2XP_038944684.1 NR_DBD_like 58..154 CDD:413390 32/75 (43%)
NR_LBD_LXR 209..444 CDD:132752 34/199 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351532
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24082
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.