DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and pparaa

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001154805.1 Gene:pparaa / 563298 ZFINID:ZDB-GENE-041210-169 Length:470 Species:Danio rerio


Alignment Length:413 Identity:97/413 - (23%)
Similarity:152/413 - (36%) Gaps:102/413 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQF-TCPFNQNCDITVVTRRFCQKCRLRKCLDI 70
            |.||.|:|.|:::....||.||.||||....|.:: .|  .:||.|....|..||.||.||||.:
Zfish    99 CRVCADRASGFHYGVHACEGCKGFFRRTIRLKLEYDKC--ERNCKIQKKNRNKCQYCRFRKCLAV 161

  Fly    71 GMKSENIMSEEDKLIKRRKIETNRAKRRLMENGTDACDADGGEERDHKAPADSS------SSNLD 129
            || |.|       .|:..:|..:..:|...|.     |..|.||...:.|...|      .:.|.
Zfish   162 GM-SHN-------AIRFGRIPQSEKQRLKAEQ-----DVSGKEEHKCQQPDMRSLARQMHEAYLK 213

  Fly   130 HYSGSQDSQSCGSADSGANGCSGRQASSPGT--QVNPLQMTAEKIVDQIVSDPDRASQAINRLMR 192
            |:..::.....        ..:|:.::.|..  .::.||...:|:|.|::.:.  ||..|:.|..
Zfish   214 HFHMNKAKARV--------FLTGKTSTPPFVIHDMDTLQHAEKKLVTQLLGNV--ASGDISTLQE 268

  Fly   193 TQKEAISVMEKVISSQKDALRLVSHLIDYPGDALKIISKFMNSPFNALTVFTKFMSSPTDGVEII 257
            .:.||    ...:..|..::..|:.|.:|    .|.:..|.:...|......|:           
Zfish   269 REVEA----RLFLFCQYASVATVTELTEY----AKAVPGFADLDLNDQVTLLKY----------- 314

  Fly   258 SKIVDSPADVVEFMQNLMHSPEDAIDIMNKFMNTPAEALRILNRILSGGGANAAQQTAD-RKPLL 321
                    .|.|.:..|:.|      .|||      :.|    .:..|||....:.... |||..
Zfish   315 --------GVYEALFTLLAS------CMNK------DGL----LVAQGGGFITREFLKSLRKPFS 355

  Fly   322 D-KEPAVKPAAPAERADTVIQSMLGNSPPISPHD-----AAVDLQYHSPGVGEQPSTSSSHPLPY 380
            | .||..:.|            |..|:..:...|     ||:..      .|::|..|:...:..
Zfish   356 DMMEPKFQFA------------MKFNALELDDSDLALFVAAIIC------CGDRPGLSNVPQIER 402

  Fly   381 IANSPDFDLKTFMQTNYNDEPSL 403
            |..|....|:..:.:|:.|...|
Zfish   403 IQESVIHSLRLHLTSNHPDNSLL 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 34/91 (37%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
pparaaNP_001154805.1 NR_DBD_Ppar 98..181 CDD:143523 34/91 (37%)
NR_LBD_PPAR 199..469 CDD:132730 56/298 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593351
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.