DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and nr1h5

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:XP_005166790.1 Gene:nr1h5 / 557500 ZFINID:ZDB-GENE-080403-3 Length:487 Species:Danio rerio


Alignment Length:236 Identity:69/236 - (29%)
Similarity:102/236 - (43%) Gaps:64/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQFTCPFNQNCDITVVTRRFCQKCRLRKCLDIG 71
            |.||||||.||::||:|||.||.||||:...|..:.|....:|::.:..||.||.||||||..:|
Zfish   130 CVVCGDKASGYHYNALTCEGCKGFFRRSVTKKAVYHCKSGGSCEMDMYMRRKCQDCRLRKCRAVG 194

  Fly    72 MKSENIMSEEDKLIKR-RKIETNRAKRRLMENGTDACDADGGEERDHKAPADSSSSNLDHYSGSQ 135
            |.:|.:::|.....|| ||                     |.:.|.|..   ||:...|.||.|:
Zfish   195 MLAECLLTEVQCQSKRLRK---------------------GSKHRGHNG---SSARAEDDYSESR 235

  Fly   136 DSQSCGSADSG-ANGCSGRQ---------------------------ASSPGTQVNPLQMTAEKI 172
            ...|....::. ::|.|..|                           :|...|.:.|.|  .||:
Zfish   236 SVSSTSRINTRVSSGFSREQRCILNRIVEAFRRYIIQDNTHCRVPLWSSLTNTHLTPPQ--TEKL 298

  Fly   173 VDQIVSDP-----DRASQAINRLMRTQKEAISVMEKVISSQ 208
            :..:.|.|     |.:.|  |.|:  ...::.||..:::.|
Zfish   299 LQFLRSVPGFDLLDSSDQ--NTLL--SSASVEVMFLLLAQQ 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 41/91 (45%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
nr1h5XP_005166790.1 NR_DBD_like 127..210 CDD:295381 37/79 (47%)
NR_LBD 288..478 CDD:299703 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593333
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D153746at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24082
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.