DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and nr1h4

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001002574.1 Gene:nr1h4 / 436847 ZFINID:ZDB-GENE-040718-313 Length:483 Species:Danio rerio


Alignment Length:338 Identity:76/338 - (22%)
Similarity:125/338 - (36%) Gaps:124/338 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQFTCPFNQNCDITVVTRRFCQKCRLRKCLDIG 71
            |.||||||.||::||:|||.||.||||:......:.|....||::.:..||.||:||||||.::|
Zfish   137 CVVCGDKASGYHYNALTCEGCKVFFRRSITKNAVYKCKSGGNCEMDMYMRRKCQECRLRKCKEMG 201

  Fly    72 MKSENIMSEEDKLIKRRKIETNRAKRRLMENGTDACDADGGEE----RDHKAPADSSSSNLDHYS 132
            |.:|.:::|         |:..  .:||.:|...:.|...|::    ||.|....::..:.::..
Zfish   202 MLAECLLTE---------IQCK--SKRLRKNTKASSDGSIGDDVVDSRDPKQVVSTTKPSKENIE 255

  Fly   133 GSQDSQSCGSADSGANGCSGRQASSPGTQVNPLQMTAEKIVDQIVSDPDRASQAINRLMRTQKEA 197
            .|||.|:                                                          
Zfish   256 LSQDQQA---------------------------------------------------------- 262

  Fly   198 ISVMEKVISSQKDALRLVSHLID------YPGDALKIISKFMNSPFNALTVFTKFMSSPTDGVEI 256
                            |:::::|      .|.|..|   |.:...|||...|.......|..|::
Zfish   263 ----------------LINYIVDAHNKHRIPQDMAK---KLLQEQFNAEENFLLLTEMATSHVQV 308

  Fly   257 ISKIVDSPADVVEF------MQNLMHSPEDAIDIMNKFMNTPAEAL-----RILNRILSGGGANA 310
            :          |||      .|:|.|  ||.|.::.   .:..||:     ::.::.|..|....
Zfish   309 L----------VEFTKNIPGFQSLDH--EDQIALLK---GSAVEAMFLRSAQVFSKKLPNGHTEV 358

  Fly   311 AQQTADRKPLLDK 323
            .:....|..:.::
Zfish   359 LEDRIRRSGISEE 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 38/90 (42%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
nr1h4NP_001002574.1 NR_DBD_FXR 134..217 CDD:143520 38/90 (42%)
NR_LBD_Fxr 258..478 CDD:132734 29/206 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24082
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.