DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and EcR

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001163061.1 Gene:EcR / 35540 FlyBaseID:FBgn0000546 Length:878 Species:Drosophila melanogaster


Alignment Length:475 Identity:119/475 - (25%)
Similarity:186/475 - (39%) Gaps:126/475 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQFTCPFNQNCDITVVTRRFCQKCRLRKCLDIG 71
            |.||||:|.||::||:|||.||.||||:......:.|.|.:.|::.:..||.||:|||:|||.:|
  Fly   264 CLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVG 328

  Fly    72 MKSENIMSEEDKLIKRRKIETNRAKRRL------MENGTDACDADGGEERDHKAPADSSSSNLDH 130
            |:.|.::.|....:|||:.:..:.|.::      ...|..:..:.||::...|...|     |..
  Fly   329 MRPECVVPENQCAMKRREKKAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILD-----LMT 388

  Fly   131 YSGSQDSQSCGSADSGANGCSGRQASSPGTQVNPL-------------QMTAEKIVDQIVSDPDR 182
            ....|.:......|.....|..|  :.|....|.|             :..:|:.:.:|:|.||.
  Fly   389 CEPPQHATIPLLPDEILAKCQAR--NIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQPDE 451

  Fly   183 ASQAINRLMR--------------------------TQKEAISVMEKVISSQKDALRLV---SHL 218
            .....:...|                          .|::.|::: |..||:...||:.   .|.
  Fly   452 NESQTDVSFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLL-KACSSEVMMLRMARRYDHS 515

  Fly   219 ID---------YPGDALKIISKFMNSPFNALTVFTKFM-SSPTDGVE--IISKIV---DSP---- 264
            .|         |..|:.|:..  |......|..|.:.| |...|.||  :::.||   |.|    
  Fly   516 SDSIFFANNRSYTRDSYKMAG--MADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEK 578

  Fly   265 ADVVEFMQNLMHSPEDAID-----IMNKFMNTP------AEALRILNRILSGGGANA----AQQT 314
            |.:||.:|:..      ||     |:|:.....      |:.|.||..:.:.|..||    :.:.
  Fly   579 AQLVEAIQSYY------IDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKL 637

  Fly   315 ADRK-PLLDKE----PAVKPAAPA------------ERADTVIQSMLG--------NSPPISPHD 354
            .:|| |...:|    .|:.|:..:            |||:.:..|:.|        :|...|   
  Fly   638 KNRKLPKFLEEIWDVHAIPPSVQSHLQITQEENERLERAERMRASVGGAITAGIDCDSASTS--- 699

  Fly   355 AAVDLQYHSPGVGEQPSTSS 374
            ||.....|.|....||..||
  Fly   700 AAAAAAQHQPQPQPQPQPSS 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 40/90 (44%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
EcRNP_001163061.1 NR_DBD_EcR 261..351 CDD:143535 39/86 (45%)
NR_LBD_EcR 420..652 CDD:132736 50/240 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24082
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.