DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and thraa

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_571471.1 Gene:thraa / 30670 ZFINID:ZDB-GENE-990415-263 Length:427 Species:Danio rerio


Alignment Length:318 Identity:82/318 - (25%)
Similarity:126/318 - (39%) Gaps:97/318 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKK---QFTCPFNQNCDITVVTRRFCQKCRLRKCL 68
            |.||||||.||::..:|||.||.|||| .:.|.   .::|.::..|.|..:||..||.||.|||:
Zfish    57 CVVCGDKATGYHYRCITCEGCKGFFRR-TIQKNLHPSYSCKYDSCCIIDKITRNQCQLCRFRKCI 120

  Fly    69 DIGMKSENIMSEEDKLIKRRKIETNRAKRR--------------------LMENGTDA---CDAD 110
            .:||..:.::.:..::.|||.||.||.||:                    |:...|:|   .:|.
Zfish   121 SVGMAMDLVLDDSKRVAKRRLIEENREKRKKEEIVKTLHNRPEPTVSEWELIRMVTEAHRHTNAQ 185

  Fly   111 GGEERDHK--APADSSSSNLDHYSGSQDSQSCGSADSGANGCSGRQASSPGTQVNPLQMT----- 168
            |...:..:  .|.|...|               .|.:..|.....:|.|..|::....:|     
Zfish   186 GPHWKQKRKFLPEDIGQS---------------PAPTSDNDKVDLEAFSEFTKIITPAITRVVDF 235

  Fly   169 AEKI--------VDQIV-----------------SDPDRASQAINRLMRTQKEAISVMEKVISSQ 208
            |:|:        .|||:                 .||:..:..::..|...:|.:         :
Zfish   236 AKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLSGEMAVSREQL---------K 291

  Fly   209 KDALRLVSHLIDYPGDALKIISKFMNSPFN------ALTVFTKFMSSPTDGVEIISKI 260
            ...|.:||       ||:..:.|.: |.||      ||......|||...|:..:.||
Zfish   292 NGGLGVVS-------DAIFDLGKSL-SQFNLDDSEVALLQAVLLMSSDRSGLTCVEKI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 41/93 (44%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
thraaNP_571471.1 Modulating 1..56
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
NR_DBD_TR 56..142 CDD:143519 36/85 (42%)
NR_LBD_TR 168..407 CDD:132733 40/206 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.