DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and Ppara

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:XP_006242213.1 Gene:Ppara / 25747 RGDID:3369 Length:605 Species:Rattus norvegicus


Alignment Length:318 Identity:73/318 - (22%)
Similarity:120/318 - (37%) Gaps:90/318 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQF-TCPFNQNCDITVVTRRFCQKCRLRKCLDI 70
            |.:|||||.||::....||.||.||||....|..: .|  :::|.|....|..||.||..|||.:
  Rat   239 CRICGDKASGYHYGVHACEGCKGFFRRTIRLKLAYDKC--DRSCKIQKKNRNKCQYCRFHKCLSV 301

  Fly    71 GMKSENI------MSEEDKLIKRRKIETNRAKRRLMENGTDACDADGGEERDHKAPADSSSSN-- 127
            ||....|      .||:.||    |.|....:..|.::.|  .|.....:|.|:|...:.:.|  
  Rat   302 GMSHNAIRFGRMPRSEKAKL----KAEILTCEHDLKDSET--ADLKSLAKRIHEAYLKNFNMNKV 360

  Fly   128 -----LDHYSGSQDSQSCGSADSGANGCSGRQASSPGTQVNPLQ---MTAEKIVDQIVSDPDRAS 184
                 |                      :|:.:::|...::.::   |..:.:|.::|::.....
  Rat   361 KARVIL----------------------AGKTSNNPPFVIHDMETLCMAEKTLVAKMVANGVENK 403

  Fly   185 QAINRLMRTQKEAISVMEKVISSQKDALRLVSHLIDYPGDALKIISKFMNSPFNALTVFTKFMSS 249
            :|..|...             ..|..::..|:.|.::    .|.|..|.|...|......|:   
  Rat   404 EAEVRFFH-------------CCQCMSVETVTELTEF----AKAIPGFANLDLNDQVTLLKY--- 448

  Fly   250 PTDGV-----EIISKIVDSPADVV---------EFMQNLMHSP-----EDAIDIMNKF 288
               ||     .::|.:::....::         ||::|| ..|     |...|...||
  Rat   449 ---GVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNL-RKPFCDIMEPKFDFAMKF 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 37/97 (38%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
PparaXP_006242213.1 NR_DBD_Ppar 238..321 CDD:143523 33/83 (40%)
NR_LBD_PPAR 338..604 CDD:132730 34/211 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.890

Return to query results.
Submit another query.