DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and Pparg

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_037256.1 Gene:Pparg / 25664 RGDID:3371 Length:505 Species:Rattus norvegicus


Alignment Length:380 Identity:99/380 - (26%)
Similarity:143/380 - (37%) Gaps:104/380 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PKN------CAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQF-TCPFNQNCDITVVTRRFCQK 61
            |.|      |.||||||.|:::....||.||.||||....|..: .|  :.||.|...:|..||.
  Rat   130 PSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRC--DLNCRIHKKSRNKCQY 192

  Fly    62 CRLRKCLDIGMKSENI------MSEEDKLIKRRKIETNRAKRRLMENGTDACDADGGEERDHKAP 120
            ||.:|||.:||....|      .:|::||              |.|..:| .|....|..|.:|.
  Rat   193 CRFQKCLAVGMSHNAIRFGRMPQAEKEKL--------------LAEISSD-IDQLNPESADLRAL 242

  Fly   121 ADSSSSNLDH-YSGSQDSQSCGSADSGANGCSGRQASSPGT--QVNPLQMTAEKIVDQIVSDPDR 182
            |       .| |.....|.....|.:.|.........||..  .:|.|.|..:||          
  Rat   243 A-------KHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKI---------- 290

  Fly   183 ASQAINRLMRTQKE-AISVMEKVISSQKDALRLVSHLIDYPGDALKIISKFMNSPFNALTVFTKF 246
            ..:.|..|....|| ||.:.:   ..|..::..|..:.:|    .|.|..|:|...|......|:
  Rat   291 KFKHITPLQEQSKEVAIRIFQ---GCQFRSVEAVQEITEY----AKNIPGFINLDLNDQVTLLKY 348

  Fly   247 MSSPTDGV-EII----SKIVDSPADVV---------EFMQNLMHSP-----EDAIDIMNKF---- 288
                  || |||    :.:::....::         ||:::| ..|     |...:...||    
  Rat   349 ------GVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSL-RKPFGDFMEPKFEFAVKFNALE 406

  Fly   289 MNTPAEALRILNRILSGGGANAAQQTADRKPLLDKEPAVKPAAPAERADTVIQSM 343
            ::....|:.|...||||          ||..||:    |||....:  |.::|::
  Rat   407 LDDSDLAIFIAVIILSG----------DRPGLLN----VKPIEDIQ--DNLLQAL 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 36/105 (34%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
PpargNP_037256.1 PPARgamma_N 31..108 CDD:403692
NR_DBD_Ppar 138..221 CDD:143523 33/84 (39%)
Interaction with FAM120B. /evidence=ECO:0000250 205..280 19/96 (20%)
NR_LBD_PPAR 237..504 CDD:132730 57/256 (22%)
9aaTAD. /evidence=ECO:0000250|UniProtKB:P37231 495..503
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.800

Return to query results.
Submit another query.