DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and Thrb

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_033406.1 Gene:Thrb / 21834 MGIID:98743 Length:475 Species:Mus musculus


Alignment Length:344 Identity:89/344 - (25%)
Similarity:132/344 - (38%) Gaps:114/344 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SPPKN---------------CAVCGDKALGYNFNAVTCESCKAFFRRNALAKK---QFTCPFNQN 48
            |||.:               |.||||||.||::..:|||.||.|||| .:.|.   .::|.:...
Mouse   101 SPPHSQKKGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRR-TIQKSLHPSYSCKYEGK 164

  Fly    49 CDITVVTRRFCQKCRLRKCLDIGMKSENIMSEEDKLIKRRKIETNRAKRR--------------- 98
            |.|..|||..||:||.:||:.:||.::.::.:..:|.||:.||.||.|||               
Mouse   165 CIIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSIGHKPEPT 229

  Fly    99 -----LMENGTD---ACDADGGEERDHK--APADSSSSNLDHYSGSQDSQSCGSADSGANGCSGR 153
                 |::..|:   |.:|.|...:..:  .|.|...:.:              .::...|....
Mouse   230 DEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPI--------------VNAPEGGKVDL 280

  Fly   154 QASSPGTQVNPLQMT-----AEKI--------VDQIV-----------------SDPDRASQAIN 188
            :|.|..|::....:|     |:|:        .|||:                 .|||..:..:|
Mouse   281 EAFSHFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPDSETLTLN 345

  Fly   189 RLMRTQKEAISVMEKVISSQKDALRLVSHLIDYPGDALKIISKFMNSPFN------ALTVFTKFM 247
            ..|...:..:         :...|.:||..|...|.:|        |.||      ||......|
Mouse   346 GEMAVTRGQL---------KNGGLGVVSDAIFDLGMSL--------SSFNLDDTEVALLQAVLLM 393

  Fly   248 SSPTDG---VEIISKIVDS 263
            ||...|   ||.|.|..||
Mouse   394 SSDRPGLACVERIEKYQDS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 41/110 (37%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
ThrbNP_033406.1 NR_DBD_TR 120..206 CDD:143519 36/86 (42%)
NR_LBD_TR 230..472 CDD:132733 43/214 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847977
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.