DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and Rarg

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_035374.3 Gene:Rarg / 19411 MGIID:97858 Length:458 Species:Mus musculus


Alignment Length:109 Identity:41/109 - (37%)
Similarity:59/109 - (54%) Gaps:17/109 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SPP------KNCAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQFTCPFNQNCDITVVTRRFCQ 60
            |||      |.|.||.||:.||::...:||.||.||||:......:||..::||.|..|||..||
Mouse    79 SPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQ 143

  Fly    61 KCRLRKCLDIGMKSENIMSEEDKLIKRRKIETNRAKRRLMENGT 104
            .|||:||.::||..|.:.::.           |:.|:.:.|.|:
Mouse   144 YCRLQKCFEVGMSKEAVRNDR-----------NKKKKEVKEEGS 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 36/92 (39%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
RargNP_035374.3 Modulating 1..89 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..83 3/3 (100%)
NR_DBD_RAR 85..165 CDD:143522 34/90 (38%)
Hinge 156..184 5/32 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..180 4/27 (15%)
NR_LBD_RAR 188..418 CDD:132735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 409..458
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.