DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and nhr-242

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001343692.1 Gene:nhr-242 / 190547 WormBaseID:WBGene00022097 Length:305 Species:Caenorhabditis elegans


Alignment Length:290 Identity:79/290 - (27%)
Similarity:122/290 - (42%) Gaps:26/290 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQFTCPFNQNCDITVVTRRFCQKCRLRKCLDIG 71
            |||||.||....:.|::|..|..||||....:|::.|..|:||:|.:.||..|:.|||:|||::|
 Worm    21 CAVCGGKASSSRYGALSCIGCLVFFRRMTCGEKKWYCLRNRNCEINIATRNTCRACRLQKCLNVG 85

  Fly    72 MKSENIMSEEDKLIKRRKIETNRAKRRLMENGTDA----CDADGGEERDHKAPADSSSSNLDHYS 132
            |....|...::  |..||.:.::..::.....|.:    |...|.:.....|....|.|.|.|..
 Worm    86 MNPNAIQRRDE--IGPRKPKVSKFSQKQYNAATSSECAMCLHIGFQNALEWANQLESFSMLSHVD 148

  Fly   133 GSQDSQSCGSA----DSGANGCSGRQASSPGTQVNPLQMTAEKIVDQIV--SDPDRASQAINRLM 191
            ........|.|    |.|.     :.|.....|...||..:....:|:.  ||.|..:|.|..:.
 Worm   149 KQNILSEYGIAFTLIDQGY-----KTARDADEQCWLLQNGSVLHCEQLFNSSDADLVNQLIANIS 208

  Fly   192 RTQKEAISVMEKVISSQKDALRLVSHLIDYPGDALKIISKFMNSPFNALTVFTKFMSSPTDGVEI 256
            :..|. :.:.|......|..|.|.|   .:||: :::.|:  .|....||...:..:.|....||
 Worm   209 QPLKR-LELDEYECGLLKSLLLLSS---SFPGE-VQLNSQ--QSRAKCLTEMLQHRNDPERFGEI 266

  Fly   257 ISKIVDSPADVVEFMQNLMHSPEDAIDIMN 286
            |..|....:.|..|......|  |..:::|
 Worm   267 ILLIGSIRSSVKLFYNQTKRS--DLFNVLN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 35/90 (39%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
nhr-242NP_001343692.1 NR_DBD_HNF4A 21..96 CDD:143518 32/74 (43%)
Hormone_recep 105..289 CDD:306586 42/197 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D153746at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.