DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr96 and Ppara

DIOPT Version :9

Sequence 1:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001106889.1 Gene:Ppara / 19013 MGIID:104740 Length:468 Species:Mus musculus


Alignment Length:318 Identity:73/318 - (22%)
Similarity:120/318 - (37%) Gaps:90/318 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQF-TCPFNQNCDITVVTRRFCQKCRLRKCLDI 70
            |.:|||||.||::....||.||.||||....|..: .|  :::|.|....|..||.||..|||.:
Mouse   102 CRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKC--DRSCKIQKKNRNKCQYCRFHKCLSV 164

  Fly    71 GMKSENI------MSEEDKLIKRRKIETNRAKRRLMENGTDACDADGGEERDHKAPADSSSSN-- 127
            ||....|      .||:.||    |.|....:..|.::.|  .|.....:|.|:|...:.:.|  
Mouse   165 GMSHNAIRFGRMPRSEKAKL----KAEILTCEHDLKDSET--ADLKSLGKRIHEAYLKNFNMNKV 223

  Fly   128 -----LDHYSGSQDSQSCGSADSGANGCSGRQASSPGTQVNPLQ---MTAEKIVDQIVSDPDRAS 184
                 |                      :|:.:::|...::.::   |..:.:|.::|::.....
Mouse   224 KARVIL----------------------AGKTSNNPPFVIHDMETLCMAEKTLVAKMVANGVEDK 266

  Fly   185 QAINRLMRTQKEAISVMEKVISSQKDALRLVSHLIDYPGDALKIISKFMNSPFNALTVFTKFMSS 249
            :|..|...             ..|..::..|:.|.::    .|.|..|.|...|......|:   
Mouse   267 EAEVRFFH-------------CCQCMSVETVTELTEF----AKAIPGFANLDLNDQVTLLKY--- 311

  Fly   250 PTDGV-----EIISKIVDSPADVV---------EFMQNLMHSP-----EDAIDIMNKF 288
               ||     .::|.:::....::         ||::|| ..|     |...|...||
Mouse   312 ---GVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNL-RKPFCDIMEPKFDFAMKF 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 37/97 (38%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
PparaNP_001106889.1 NR_DBD_Ppar 101..184 CDD:143523 33/83 (40%)
NR_LBD_PPAR 201..467 CDD:132730 34/211 (16%)
Required for heterodimerization with RXRA. /evidence=ECO:0000250 304..433 13/69 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847973
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.890

Return to query results.
Submit another query.