DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC6 and Emc6

DIOPT Version :10

Sequence 1:NP_651320.1 Gene:EMC6 / 42992 FlyBaseID:FBgn0039259 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_079594.1 Gene:Emc6 / 66048 MGIID:1913298 Length:110 Species:Mus musculus


Alignment Length:96 Identity:55/96 - (57%)
Similarity:75/96 - (78%) Gaps:0/96 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SEGAIRNNISAVEYCRTSMAAISGCAAGILGLSGTLGFLFYFLSVFVLWILVLVKSGTQWRKFFI 82
            ||.|:|.|.:.::|||||::|:||..||||||:|..||:||.|:..:|.:|:::|:|.:|.|:|.
Mouse    15 SEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFK 79

  Fly    83 NRRNLLTNQFMGGLCTYVLFWTFLYGMVHVY 113
            :||.|.|...:|||.||||||||||||||||
Mouse    80 SRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC6NP_651320.1 EMC6 28..104 CDD:462067 39/75 (52%)
Emc6NP_079594.1 EMC6 25..101 CDD:462067 39/75 (52%)

Return to query results.
Submit another query.