DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalT7 and B4GALT6

DIOPT Version :9

Sequence 1:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_004766.2 Gene:B4GALT6 / 9331 HGNCID:929 Length:382 Species:Homo sapiens


Alignment Length:233 Identity:81/233 - (34%)
Similarity:122/233 - (52%) Gaps:27/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFA--SDVY 138
            |:|:|:|||:|.|.|..|..|:...|::|.:....:|:.|.....||||.|.||||:.|  ..|:
Human   157 KVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVW 221

  Fly   139 DYIAMHDVDLLPLNDNLLYEYPSSLG--PLHIAGPKLHPKY----HYDNFVGGILLVRREHFKQM 197
            |.:..||||.||.||...|    ..|  |.|.|. || .||    .|..|.||:..:..|.|:::
Human   222 DCVIFHDVDHLPENDRNYY----GCGEMPRHFAA-KL-DKYMYILPYKEFFGGVSGLTVEQFRKI 280

  Fly   198 NGMSNQYWGWGLEDDEFFVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQK--E 260
            ||..|.:||||.|||:.:.|:..||..||||:. ..|...:..|     |.:.:.|.....|  .
Human   281 NGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEG-DLGKYKSIPH-----HHRGEVQFLGRYKLLR 339

  Fly   261 MTRKRDHKTGLDNVKYKILKVHEMLIDQVPVTI-LNIL 297
            .:::|.:..||:|:.|:    .::|:|::...| :|::
Human   340 YSKERQYIDGLNNLIYR----PKILVDRLYTNISVNLM 373

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 81/233 (35%)
B4GALT6NP_004766.2 b4GalT 155..371 CDD:132999 80/229 (35%)
UDP-alpha-D-galactose binding. /evidence=ECO:0000250|UniProtKB:Q9UBV7 163..167 3/3 (100%)
UDP-alpha-D-galactose binding. /evidence=ECO:0000250|UniProtKB:Q9UBV7 202..204 1/1 (100%)