DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalT7 and TMA20

DIOPT Version :9

Sequence 1:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_010923.3 Gene:TMA20 / 856725 SGDID:S000002957 Length:181 Species:Saccharomyces cerevisiae


Alignment Length:87 Identity:16/87 - (18%)
Similarity:32/87 - (36%) Gaps:35/87 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 DYIAMHDVD-----------LLPLNDNLLYEYPSSLGPLHI---------------------AGP 171
            |.|.::.||           |:| :..|::::|.:...:.:                     ||.
Yeast    56 DKIQLYSVDGEVLFFQKFDELIP-SLKLVHKFPEAYPTVQVDRGAIKFVLSGANIMCPGLTSAGA 119

  Fly   172 KLHPKYHYDNFVGGILLVRREH 193
            .|.|...|:.  |.|:::..|:
Yeast   120 DLPPAPGYEK--GTIVVINAEN 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 16/87 (18%)
TMA20NP_010923.3 Tma20 12..181 CDD:224927 16/87 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.