DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalT7 and b4galt1l

DIOPT Version :9

Sequence 1:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001070727.2 Gene:b4galt1l / 768123 ZFINID:ZDB-GENE-061013-84 Length:350 Species:Danio rerio


Alignment Length:290 Identity:80/290 - (27%)
Similarity:141/290 - (48%) Gaps:44/290 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SNPLAKLAGGGEGVSVIKKEPADEKQP---------------------------QPHDHGASVHK 76
            |.|.|..:..|:.:.:..:||.....|                           :|.|..|. .|
Zfish    67 SRPAANASSNGQELQICPEEPPRLVGPLRVEFSDPITLEMVRTENSVLQEGGRFRPPDCIAR-QK 130

  Fly    77 MALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFASDVYDY- 140
            :|:::|||:|.|.|..::.::...|:||.:.:.::|:||.....||||.|:|:|:..|...||| 
Zfish   131 VAMIIPFRNRDEHLKFWLYYLHPILQRQQLDYGVYVINQDGEDTFNRAKLLNIGYAEALKEYDYD 195

  Fly   141 -IAMHDVDLLPLNDNLLYEYPSSLGPLHIAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQY 204
             ....||||:|::|..:|:..:....|.::..|...:..|..:.||:..:.:|.|.::||..|.|
Zfish   196 CFVFSDVDLIPMDDRNIYKCYNQPRHLAVSMDKFGFRLPYTQYFGGVSSLSKEQFLKINGFPNNY 260

  Fly   205 WGWGLEDDEFFVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQ-----KCFNQKEMTRK 264
            ||||.|||:.|.||...|:.::||..: .|......|       :||.|     :.|::...||:
Zfish   261 WGWGGEDDDIFNRISSRGMSISRPDGL-LGRCRMIRH-------ERDKQNDPNPQRFDRIAHTRE 317

  Fly   265 RDHKTGLDNVKYKILKVH-EMLIDQVPVTI 293
            .....|::::||.::|:. ::|..::.|.:
Zfish   318 TMATDGINSLKYNVVKIEKDLLFTKITVDV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 70/227 (31%)
b4galt1lNP_001070727.2 b4GalT 128..346 CDD:132999 69/226 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.