DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalT7 and B4galt6

DIOPT Version :9

Sequence 1:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_062711.1 Gene:B4galt6 / 56386 MGIID:1928380 Length:382 Species:Mus musculus


Alignment Length:233 Identity:80/233 - (34%)
Similarity:121/233 - (51%) Gaps:27/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFA--SDVY 138
            |:|:|:|||:|.|.|..|..|:...|::|.:....:|:.|.....||||.|.||||:.|  ...:
Mouse   157 KVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDRAW 221

  Fly   139 DYIAMHDVDLLPLNDNLLYEYPSSLG--PLHIAGPKLHPKY----HYDNFVGGILLVRREHFKQM 197
            |.:..||||.||.||...|    ..|  |.|.|. || .||    .|..|.||:..:..|.|:::
Mouse   222 DCVIFHDVDHLPENDRNYY----GCGEMPRHFAA-KL-DKYMYILPYKEFFGGVSGLTVEQFRKI 280

  Fly   198 NGMSNQYWGWGLEDDEFFVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQK--E 260
            ||..|.:||||.|||:.:.|:..||..||||:      .|...:|...:|.:.:.|.....|  .
Mouse   281 NGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPE------GDLGKYISIPHHHRGEVQFLGRYKLLR 339

  Fly   261 MTRKRDHKTGLDNVKYKILKVHEMLIDQVPVTI-LNIL 297
            .:::|.:..||:|:.|    ..::|:|::...| :|::
Mouse   340 YSKERQYIDGLNNLLY----TPKILVDRLYTNISVNLM 373

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 80/233 (34%)
B4galt6NP_062711.1 b4GalT 155..371 CDD:132999 79/229 (34%)
UDP-alpha-D-galactose binding. /evidence=ECO:0000250|UniProtKB:Q9UBV7 163..167 3/3 (100%)
UDP-alpha-D-galactose binding. /evidence=ECO:0000250|UniProtKB:Q9UBV7 202..204 1/1 (100%)