DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalT7 and b4galt3

DIOPT Version :9

Sequence 1:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_009295048.1 Gene:b4galt3 / 561756 ZFINID:ZDB-GENE-110624-1 Length:416 Species:Danio rerio


Alignment Length:342 Identity:100/342 - (29%)
Similarity:157/342 - (45%) Gaps:64/342 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 INWVFVCGLSFCLGG----IAVL---------------------SLM-----PLGSDCV---CPL 38
            :.:.|...|.|.|||    ::||                     ||:     |.|::..   |.|
Zfish    19 VGFQFAFVLYFSLGGFRGLVSVLLHSTEPEIDYSRPHDVYTNLTSLLLHHPGPSGAEQQLRDCSL 83

  Fly    39 SNPLAKLAGGGEGVSVIKKEPAD-----EKQP--------QPHDHGASVHKMALLVPFRDRFEEL 90
            .:||  |.|   .|||....|..     ||.|        :|.|.... |..|::||:|:|...|
Zfish    84 PSPL--LVG---PVSVHLSSPPSLEEIKEKNPLVTLGGHYRPPDCEPR-HHTAIVVPYRNRQSHL 142

  Fly    91 LQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQ--FASDVYDYIAMHDVDLLPLND 153
            ...:.|:..||:||.:.:.|::::|.....||||.|:|||.:  ...:.:..|.:|||||||.||
Zfish   143 RTLLYHLHPFLQRQQLHYAIYIVHQSGNSTFNRAKLLNVGVREVLKEEDWSCIFLHDVDLLPEND 207

  Fly   154 NLLYE-YPSSLGPLHIAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLEDDEFFVR 217
            :..|. :|.:...|.:|..|...:..|..:.||:..|..:.:.:|||..|||||||.|||:...|
Zfish   208 HNTYTCHPQNPTHLSVAMDKFRYRLPYSQYFGGVSAVTPQQYLKMNGFPNQYWGWGGEDDDIAAR 272

  Fly   218 -----IRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDNVKYK 277
                 :|.:|:::.||. :..|......|..::.:.:...:  |:..:.||......||:::.|:
Zfish   273 PRRDQVRLSGMKIMRPP-LAIGHYKMIKHKGDQGNEQNPRR--FDLLKRTRLNWRSDGLNSLTYE 334

  Fly   278 IL-KVHEMLIDQVPVTI 293
            :| |..|.|...:.|.|
Zfish   335 LLSKKLEPLYTNLSVNI 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 73/228 (32%)
b4galt3XP_009295048.1 b4GalT 126..350 CDD:132999 71/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.