DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalT7 and b4galt1.2

DIOPT Version :9

Sequence 1:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001016664.1 Gene:b4galt1.2 / 549418 XenbaseID:XB-GENE-1015082 Length:362 Species:Xenopus tropicalis


Alignment Length:221 Identity:72/221 - (32%)
Similarity:113/221 - (51%) Gaps:16/221 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QPHDHGASVHKMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVG 130
            :|.|..| :.|:|:::|||:|.|.|..::.:|...||||.:.:.::|:||.....||||.|:|:|
 Frog   132 RPKDCNA-LQKVAIIIPFRNRDEHLKYWLYYMHPILKRQQLDYGVYVINQDGDKTFNRAKLLNIG 195

  Fly   131 F--QFASDVYDYIAMHDVDLLPLNDNLLYEYPSSLGPLHIAGPKLHPKYHYDNFVGGILLVRREH 193
            :  ......||.....||||:|::|...|...:....|..|..|......|:.|.||:..:.:|.
 Frog   196 YVESLKDYAYDCFVFSDVDLIPMDDRNTYRCFNQPRHLSAAMDKFGFGLPYNQFFGGVSALSKEQ 260

  Fly   194 FKQMNGMSNQYWGWGLEDDEFFVRIRDAGLQVTRPQNIKTGTNDTF-----SHIHNRYHRKRDTQ 253
            |.::||..|.|||||.|||:.:.||...|:.::||        ||.     ...|||..:.....
 Frog   261 FLKINGFPNNYWGWGGEDDDIYNRIASRGMYISRP--------DTLIGRCRMIRHNRDDKNDPNP 317

  Fly   254 KCFNQKEMTRKRDHKTGLDNVKYKIL 279
            |.|:....||:.....|::.:.||::
 Frog   318 KRFDLLAHTRQTMDSDGINTLSYKVV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 69/212 (33%)
b4galt1.2NP_001016664.1 b4GalT 140..357 CDD:132999 69/212 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.