DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalT7 and b4galt5

DIOPT Version :9

Sequence 1:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001016385.1 Gene:b4galt5 / 549139 XenbaseID:XB-GENE-982971 Length:384 Species:Xenopus tropicalis


Alignment Length:227 Identity:77/227 - (33%)
Similarity:115/227 - (50%) Gaps:32/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGF-QFASDV-Y 138
            |:|:|:|||:|.|.|.....|:...|:||.:....:|:.|.....||||.|.|||| :...|: :
 Frog   159 KVAILIPFRNRHEHLPVLFKHLIPMLQRQRLQFAFYVVEQAGNQPFNRAMLFNVGFLEAMKDLDW 223

  Fly   139 DYIAMHDVDLLPLNDNLLY--EYPSSLGPLHIAGPKLHPKY----HYDNFVGGILLVRREHFKQM 197
            |.:..||||.:|.:|...|  |:.    |.|.|. || .||    .|:.|.||:..:..|.|:::
 Frog   224 DCLIFHDVDHIPESDRNYYGCEHM----PRHFAA-KL-DKYMYLLPYNEFFGGVSGLTVEQFRKI 282

  Fly   198 NGMSNQYWGWGLEDDEFFVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMT 262
            ||..|.:||||.|||:.:.|::.||..||||:. ..|...:..|     |.:.:.|.......:.
 Frog   283 NGFPNAFWGWGGEDDDLWNRVQYAGYTVTRPEG-DIGKYKSIPH-----HHRGEVQFLGRYALLR 341

  Fly   263 RKRDHKT--GLDNVK----------YKILKVH 282
            |.::.:|  ||:|:.          ||.:.||
 Frog   342 RSKERQTMDGLNNLNYSPNITYNTFYKNITVH 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 77/227 (34%)
b4galt5NP_001016385.1 b4GalT 157..373 CDD:132999 75/225 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.