DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalT7 and b4galt4

DIOPT Version :9

Sequence 1:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001007402.2 Gene:b4galt4 / 492760 ZFINID:ZDB-GENE-041114-103 Length:353 Species:Danio rerio


Alignment Length:290 Identity:90/290 - (31%)
Similarity:140/290 - (48%) Gaps:53/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 CPLSNPLAKLAGGGEGVSVIKKEPA-------------DEKQPQPHDHGASVHKMALLVPFRDRF 87
            ||.::||.:      |...:..||:             .|.|.:|.|..|. ..:|:|:|.|:|.
Zfish    83 CPENSPLLR------GSLKLTFEPSLTLEQVEIENAEVVEGQYKPSDCTAR-QSVAILIPHRNRE 140

  Fly    88 EELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFASDVY--DYIAMHDVDLLP 150
            :.||..:.|:..||:||.:.:.::|::|.....||||.|:|||:..|...|  |....|||||:|
Zfish   141 KHLLYLLYHLHPFLQRQQLHYAVYVIHQAGDATFNRAKLLNVGYLEALKDYNWDCFIFHDVDLVP 205

  Fly   151 LNDNLLYEYPSSLGPLHI------AGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGL 209
            .||:.||.....  |.|:      .|.||    .|..:.||:..:.::.|.::||..|.|||||.
Zfish   206 ENDHNLYMCAKQ--PKHLVVGRNSTGYKL----RYKGYFGGVSAMTKDQFHKVNGFPNSYWGWGG 264

  Fly   210 EDDEFFVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEM-TRKRDHKT---- 269
            |||:..:|::...:.:.||..........|   ||     ||:....|:..| ..:|.|:|    
Zfish   265 EDDDLRIRVQLQKMAIVRPPPEVARYTMVF---HN-----RDSGNQVNKDRMQLLRRTHQTWKND 321

  Fly   270 GLDNVKYKILKVHEMLIDQVPVTILNILLD 299
            ||::..||::.||     :.|:.| |:.:|
Zfish   322 GLNSCSYKVMSVH-----RAPLYI-NVTVD 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 77/236 (33%)
b4galt4NP_001007402.2 b4GalT 127..345 CDD:132999 77/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.