DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalT7 and b4galt7

DIOPT Version :9

Sequence 1:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_021336677.1 Gene:b4galt7 / 445022 ZFINID:ZDB-GENE-040727-3 Length:328 Species:Danio rerio


Alignment Length:304 Identity:144/304 - (47%)
Similarity:193/304 - (63%) Gaps:23/304 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VFVCGLSFCLGGIAVLSLMPLGSDCVCPLSNPLAKLAGGGEGVSVIKKEPA--DEKQPQPHDHGA 72
            |||.|           ||:.:...|...:|..        .|.|.:.::|.  |::.....|...
Zfish    46 VFVFG-----------SLLWVQLTCTGDMSQT--------AGYSHLPQQPCPIDKQSSHVDDPSW 91

  Fly    73 SVHKMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFASDV 137
            ..|||||:||||:||||||.|||:|.|||.::.:.|.||::||||.|||||||||||||..:.:.
Zfish    92 GPHKMALIVPFRERFEELLVFVPYMHAFLNKKKIRHKIFIINQVDHFRFNRASLINVGFMESGND 156

  Fly   138 YDYIAMHDVDLLPLNDNLLYEYPSSLGPLHIAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSN 202
            .||||||||||||.|::|.|.:|.. ||.|:|.|:|||.|||..:||||||:.::|:...|||||
Zfish   157 TDYIAMHDVDLLPQNEDLNYGFPVD-GPFHVASPELHPLYHYKTYVGGILLLTKKHYLACNGMSN 220

  Fly   203 QYWGWGLEDDEFFVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDH 267
            ::||||.||||||.|::.|.|::.||..|.|||. ||.|||:...||||.::...||:...|.|.
Zfish   221 RFWGWGREDDEFFRRLKAANLELFRPTGITTGTK-TFRHIHDPAWRKRDQKRIAAQKQEQFKVDP 284

  Fly   268 KTGLDNVKYKILKVHEMLIDQVPVTILNILLDCDVNKTPWCDCS 311
            :.||.|::||:....|:.|...|.|::|..::||:|:||||..|
Zfish   285 EGGLSNLRYKVESRKEVSISGAPCTVINTFVECDLNQTPWCQFS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 123/223 (55%)
b4galt7XP_021336677.1 b4GalT 93..316 CDD:132999 123/224 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596035
Domainoid 1 1.000 121 1.000 Domainoid score I5701
eggNOG 1 0.900 - - E1_KOG3917
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5248
Inparanoid 1 1.050 280 1.000 Inparanoid score I2886
OMA 1 1.010 - - QHG48176
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 1 1.000 - - FOG0008371
OrthoInspector 1 1.000 - - oto40553
orthoMCL 1 0.900 - - OOG6_106739
Panther 1 1.100 - - LDO PTHR19300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6358
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.