DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalT7 and beta4GalNAcTA

DIOPT Version :9

Sequence 1:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_610946.1 Gene:beta4GalNAcTA / 36585 FlyBaseID:FBgn0027538 Length:403 Species:Drosophila melanogaster


Alignment Length:246 Identity:81/246 - (32%)
Similarity:134/246 - (54%) Gaps:25/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EGVSVIKKEPADEKQP----QPHDHGASVHKMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHI 110
            |.:.||:.|.....:|    :|.:..|. |.:|::||||||:..||.|:.::..||.:|.:|:.|
  Fly   153 ESLDVIEAELGPLLRPGGAFEPENCNAQ-HHVAIVVPFRDRYAHLLLFLRNIHPFLMKQRIAYRI 216

  Fly   111 FVLNQVDRFRFNRASLINVGFQFASDVY--DYIAMHDVDLLPLNDNLLYEYPSSLGPLHIAGPKL 173
            |::.|.:...||||:::|:|:..|..:|  |....||||||||:|..||..|.....:.:|...|
  Fly   217 FIVEQTNGKPFNRAAMMNIGYLEALKLYQWDCFIFHDVDLLPLDDRNLYNCPRQPRHMSVAIDTL 281

  Fly   174 HPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLEDDEFFVRIRDAGLQVTR-PQNIKTGTND 237
            :.:..|.:..||:..:.||||:.:||.||.::|||.|||:...|::.|.|.::| |.||.     
  Fly   282 NFRLPYRSIFGGVSAMTREHFQAVNGFSNSFFGWGGEDDDMSNRLKHANLFISRYPVNIA----- 341

  Fly   238 TFSHIHNRY----HRK-RDTQKCFNQKEMTRKRDHKTGLDNVKYKILKVHE 283
                   ||    |:| :...|.:...:....:..:.|::::||.|..:.:
  Fly   342 -------RYKMLKHQKEKANPKRYENLQNGMSKIEQDGINSIKYSIYSIKQ 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 74/217 (34%)
beta4GalNAcTANP_610946.1 b4GalT 181..395 CDD:132999 74/217 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452036
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.