DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalT7 and B4galt2

DIOPT Version :9

Sequence 1:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001101435.1 Gene:B4galt2 / 313536 RGDID:1305358 Length:369 Species:Rattus norvegicus


Alignment Length:223 Identity:73/223 - (32%)
Similarity:124/223 - (55%) Gaps:11/223 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 MALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFA---SDVY 138
            :|:::|||.|...|..::.::...|:||.:.:.::|:||.....||||.|:||||..|   ...|
  Rat   142 VAVIIPFRHREHHLRYWLHYLHPMLRRQRLRYGVYVINQHGEETFNRAKLLNVGFLEALKEDATY 206

  Fly   139 DYIAMHDVDLLPLNDNLLYEYPSSLGPLH--IAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMS 201
            |.....||||:|::|..||.....  |.|  ||..|...:..|.::.||:..:.:..|.::||..
  Rat   207 DCFIFSDVDLVPMDDRNLYRCGDQ--PRHFAIAMDKFGFRLPYASYFGGVSGLSKAQFLRINGFP 269

  Fly   202 NQYWGWGLEDDEFFVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRD 266
            |:|||||.|||:.|.||...|::::|| :::.|......|..:: |.:.:.|: ||:.:.|:...
  Rat   270 NEYWGWGGEDDDIFNRISLTGMKISRP-DVRIGRYRMIKHDRDK-HNEPNPQR-FNKIQNTKMSM 331

  Fly   267 HKTGLDNVKYKILKV-HEMLIDQVPVTI 293
            ...|:.:|:|::|:| .:.|...:.|.|
  Rat   332 KWDGIGSVRYRVLEVSRQPLFTNITVDI 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 73/223 (33%)
B4galt2NP_001101435.1 b4GalT 142..358 CDD:132999 71/220 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.